1599441-71-0 Basic information More..
Product Name:Super-TDU
Synonyms:Super-TDU;Super-TDU TFA
CAS:1599441-71-0
MF:C237H370N66O69S
MW:5279.9395
EINECS:
Mol File:1599441-71-0.mol
1599441-71-0
Information Error Report
Your Email:
1599441-71-0 Recommend Suppliers
Recommend You Select Member Companies...
Company Name: Shenzhen Nexconn Pharmatechs Ltd      Recommend     Complaint
Tel: +86-755-89396905
FAX:
Email: admin@nexconn.com
Nationality: China
Products Intro: Product Name:Super-TDU
CAS:1599441-71-0
Purity:98% Package:1KG;10KG;50KG
CB Index: 58
WebSite: www.chemicalbook.com/ShowSupplierProductsList31188/0_EN.htm
Related Information: Sales Network   Catalog(10399)   User Evaluation
Company Name: Career Henan Chemica Co      Recommend     Complaint
Tel: +86-0371-86658258
FAX: 0371-86658258
Email: laboratory@coreychem.com
Nationality: China
Products Intro: Product Name:Super-TDU
CAS:1599441-71-0
Purity:99% Package:1KG;7USD
CB Index: 58
WebSite: www.coreychem.com/
Related Information: Sales Network   Catalog(30203)   User Evaluation
Company Name: LEON (NANJING) BIOTECHNOLOGY CO., LTD.      Recommend     Complaint
Tel:
FAX:
Email: sales.njleonbiotech@gmail.com
Nationality: China
Products Intro: Product Name:Super-TDU
CAS:1599441-71-0
CB Index: 58
WebSite: www.njleonbiotech.com
Related Information: Sales Network   Catalog(5482)   User Evaluation
Company Name: ShangHai Caerulum Pharma Discovery Co., Ltd.      Recommend    Complaint
Tel: 18149758185
FAX:
Email: sales-cpd@caerulumpharma.com
Products Intro: Product Name:Super-TDU
CAS:1599441-71-0
Purity:98% Package:1g;10g;100g   More...
CB Index: 58
WebSite: www.caerulumpharma.com
Related Information: Sales Network   Catalog(3493)   User Evaluation
Company Name: Nanjing Leon Biological Technology Co., Ltd.      Recommend    Complaint
Tel: 025-84523390 -127;
FAX: 84523390
Email: sales@njleonbiotech.com
Products Intro: Product Name:Super-TDU
CAS:1599441-71-0
Remarks:SVDDHFAKSLGDTWLQIGGSGNPKTANVPQTVPMRLRKLPDSFFKPPE   More...
CB Index: 55
WebSite: http://www.njleonbiotech.com
Related Information: Sales Network   Catalog(5501)   User Evaluation
Company Name: Nanjing Peptide Biotech Ltd.      Recommend    Complaint
Tel: 025-58361106-805
FAX: 025-58361106-806
Email: zhao.xu@njpeptide.com
Products Intro: Product Name:Super-TDU
CAS:1599441-71-0
Purity:90%HPLC,95%HPLC,98%HPLC Package:5mg,20mg,100mg,250mg,500mg,1g   More...
CB Index: 55
WebSite: http://www.njpeptide.com
Related Information: Sales Network   Catalog(9976)   User Evaluation
Company Name: Chengdu Youngshe Chemical Co., Ltd.      Recommend    Complaint
Tel: +86-17380623303
FAX: 028-62328193
Email: Caroline@youngshechem.com
Products Intro: Product Name:Super-TDU
CAS:1599441-71-0
Purity:95% Package:1G; 10G; 100G   More...
CB Index: 58
WebSite: https://shop326109856.taobao.com/
Related Information: Sales Network   Catalog(4731)   User Evaluation
Company Name: Hangzhou Peptidego Biotech Co.,Ltd.      Recommend    Complaint
Tel: 0571-87213919
FAX:
Email: Eric@peptidego.com
Products Intro: Product Name:Super-TDU
CAS:1599441-71-0
Purity:95% or 98% Package:1mg;5mg;10mg;50mg;100mg,1g or according to customer's detail requirement.   More...
CB Index: 58
WebSite: peptidego.com
Related Information: Sales Network   Catalog(7858)   User Evaluation
1 2 3 4 5
Tag: 1599441-71-0
  • HomePage | About Us | Member Companies | Advertising | Contact us | Previous WebSite | MSDS | CAS Index | CAS DataBase | Privacy | Terms
  • All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.
    According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.
  • Copyright © 2023 ChemicalBook All rights reserved.