H-Ser-Arg-Ala-His-Gln-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Gly-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2 Basic information More..
Product Name:H-Ser-Arg-Ala-His-Gln-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Gly-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2
Synonyms:PRRP31 (BOVINE);SRAHQHSMEIRTPDINPAWYAGRGIRPVGRF-NH2;PREPROLACTIN (23-53) (BOVINE);PROLACTIN-RELEASING PEPTIDE (1-31) (BOVINE);SER-ARG-ALA-HIS-GLN-HIS-SER-MET-GLU-ILE-ARG-THR-PRO-ASP-ILE-ASN-PRO-ALA-TRP-TYR-ALA-GLY-ARG-GLY-ILE-ARG-PRO-VAL-GLY-ARG-PHE-NH2;PrRP31 (bovine), Preprolactin (23-53) (bovine);H-Ser-Arg-Ala-His-Gln-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Gly-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2
CAS:
MF:
MW:0
EINECS:
Mol File:Mol File
H-Ser-Arg-Ala-His-Gln-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Gly-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2
Information Error Report
Your Email:
Browse by province H-Ser-Arg-Ala-His-Gln-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Gly-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2 Suppliers Global suppliers
Beijing(2) Guangdong(2) Jiangsu(5) Member(24)
Shanghai(6) Zhejiang(6) Hong Kong(1) All(24)
Sichuan(1) Fujian(1)
H-Ser-Arg-Ala-His-Gln-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Gly-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2 Recommend Suppliers
Recommend You Select Member Companies
Company Name: GL Biochem (Shanghai) Ltd      Recommend    Complaint
Tel: 21-61263452 13641803416
Email: ymbetter@glbiochem.com
Products Intro: Product Name:Prolactin Releasing Peptide (1-31), bovine;SRAHQHSMEIRTPDINPAWYAGRGIRPVGRF-NH2
Purity:95% HPLC 98% HPLC Package:1mg,5mg,10mg,25mg,100mg,1g,10g  More...
CB Index: 64
WebSite: http://www.glschina.com/
Related Information: Sales Network   Catalog(9981)   User Evaluation(7)
Company Name: Shanghai Hanhong Scientific Co.,Ltd.      Recommend    Complaint
Tel: 021-54306202 13764082696
Email: info@hanhongsci.com
Products Intro: Product Name:Prolactin-Releasing Peptide (1-31) (bovine)
Remarks:271P01  More...
CB Index: 64
WebSite: https://www.hanhongsci.com
Related Information: Sales Network   Catalog(42917)   User Evaluation(28)
Company Name: Chemsky (shanghai) International Co.,Ltd      Recommend    Complaint
Tel: 021-50135380
Email: shchemsky@sina.com
Products Intro: Product Name:Prolactin-Releasing Peptide (1-31) (bovine);H-Ser-Arg-Ala-His-Gln-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Gly-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2;PrRP31 (bovine), Preprolactin (23-53) (bovine)
Purity:99% Package:1.0Mg  More...
CB Index: 60
WebSite: www.shchemsky.com
Related Information: Sales Network   Catalog(15350)   User Evaluation(2)
Company Name: Beijing Solarbio Science & Tecnology Co., Ltd.      Recommend    Complaint
Tel: 17801761073 18101056239
Email: 3193328036@qq.com
Products Intro: Product Name:Prolactin-Releasing Peptide (1-31), bovine
  
CB Index: 68
WebSite: http://www.solarbio.com
Related Information: Sales Network   Catalog(28150)   User Evaluation(1)
Company Name: Chengdu Youngshe Chemical Co., Ltd.      Recommend    Complaint
Tel: +86-17380623303
Email: Caroline@youngshechem.com
Products Intro: Product Name:Prolactin Releasing Peptide (1-31), bovine
Purity:95% Package:1G; 10G; 100G  
CB Index: 58
WebSite: https://shop326109856.taobao.com/
Related Information: Sales Network   Catalog(4726)   User Evaluation
Company Name: Hangzhou Peptidego Biotech Co.,Ltd.      Recommend    Complaint
Tel: 0571-87213919 15967184799
Email: Eric@peptidego.com
Products Intro: Product Name:Prolactin-Releasing Peptide (1-31) (bovine)
Purity:95% or 98% Package:1mg;5mg;10mg;50mg;100mg,1g or according to customer's detail requirement.  
CB Index: 58
WebSite: peptidego.com
Related Information: Sales Network   Catalog(7872)   User Evaluation
Company Name: Nanjing Meihao Pharmaceutical Technology Co., Ltd.      Recommend    Complaint
Tel: meitaochem@126.com
Email: meitaochem@126.com
Products Intro: Product Name:Prolactin Releasing Peptide (1-31), bovine;SRAHQHSMEIRTPDINPAWYAGRGIRPVGRF-NH2
Purity:99% HPLC Package:500g;1kg;5kg;25kg  
CB Index: 58
WebSite: www.chemicalbook.com/ShowSupplierProductsList31244/0_EN.htm
Related Information: Sales Network   Catalog(19087)   User Evaluation
Company Name: Hangzhou Go Top Peptide Biotech      Recommend    Complaint
Tel: 0571-88211921 17357109671
Email: sales3@gotopbio.com
Products Intro: Product Name:Prolactin Releasing Peptide (1-31), bovine
Purity:95%-98% HPLC Package:1mg;10mg;100mg;1g;100g  
CB Index: 58
WebSite: www.gotopbio.com/
Related Information: Sales Network   Catalog(2988)   User Evaluation
1 2 3
Tag: H-Ser-Arg-Ala-His-Gln-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Gly-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2
  • HomePage | About Us | Member Companies | Advertising | Contact us | Previous WebSite | MSDS | CAS Index | CAS DataBase | Privacy | Terms
  • All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.
    According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.
  • Copyright © 2023 ChemicalBook All rights reserved.