(H-Ser-Arg-Ala-His-Gln-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Gly-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2)

Request For Quotation

H-Ser-Arg-Ala-His-Gln-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Gly-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2 Basic information More..

Product Name:	H-Ser-Arg-Ala-His-Gln-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Gly-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2
Synonyms:	PRRP31 (BOVINE);SRAHQHSMEIRTPDINPAWYAGRGIRPVGRF-NH2;PREPROLACTIN (23-53) (BOVINE);PROLACTIN-RELEASING PEPTIDE (1-31) (BOVINE);SER-ARG-ALA-HIS-GLN-HIS-SER-MET-GLU-ILE-ARG-THR-PRO-ASP-ILE-ASN-PRO-ALA-TRP-TYR-ALA-GLY-ARG-GLY-ILE-ARG-PRO-VAL-GLY-ARG-PHE-NH2;PrRP31 (bovine), Preprolactin (23-53) (bovine);H-Ser-Arg-Ala-His-Gln-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Gly-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2
CAS:
MF:
MW:	0
EINECS:
Mol File:	Mol File

Information Error Report

Your Email:

Browse by Nationality H-Ser-Arg-Ala-His-Gln-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Gly-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2 Suppliers

China suppliers

United States(2)

All(2)

H-Ser-Arg-Ala-His-Gln-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Gly-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2 Recommend Suppliers

Recommend You Select Member Companies.

Company Name:	Chem-Impex International, Inc. Recommend Complaint
Tel:	800 869-9290 US and Canada only
Email:
Nationality:	United States
Products Intro:
CB Index:	64
WebSite:	www.chemimpex.com
Related Information:	Sales Network Catalog(6721) User Evaluation(4)

Company Name:	AnaSpec, Inc. Recommend Complaint
Tel:	800 452 5530
Email:	service@anaspec.com
Nationality:	United States
Products Intro:
CB Index:	77
WebSite:	www.anaspec.com
Related Information:	Sales Network Catalog(4870) User Evaluation

Tag: H-Ser-Arg-Ala-His-Gln-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Gly-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2

HomePage | About Us | Member Companies | Advertising | Contact us | Previous WebSite | MSDS | CAS Index | CAS DataBase | Privacy | Terms
All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.
According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.