(Glucagon-like peptide 1 (7-36)-Lys(biotin), amide, human)

Glucagon-like peptide 1 (7-36)-Lys(biotin), amide, human Basic information More..
Product Name:Glucagon-like peptide 1 (7-36)-Lys(biotin), amide, human
Synonyms:HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRK(BIOTIN)-NH2;H-HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-LYS(BIOTIN)-NH2;GLP-1 (7-36)-Lys(Biotin), amide, human;Preproglucagon (78-107)-Lys(Biotin), amide, human;Glucagon-like peptide 1 (7-36)-Lys(biotin), amide, human
CAS:
MF:
MW:0
EINECS:
Mol File:Mol File
Glucagon-like peptide 1 (7-36)-Lys(biotin), amide, human
Information Error Report
Your Email:
Browse by Nationality Glucagon-like peptide 1 (7-36)-Lys(biotin), amide, human Suppliers China suppliers
United States(1) All(1)
Glucagon-like peptide 1 (7-36)-Lys(biotin), amide, human Recommend Suppliers
Recommend You Select Member Companies.
Company Name: AnaSpec, Inc.    Recommend    Complaint
Tel: 800 452 5530
Email: service@anaspec.com
Nationality: United States
Products Intro:
CB Index: 77
WebSite: www.anaspec.com
Related Information: Sales Network   Catalog(4870)   User Evaluation
1
Tag: Glucagon-like peptide 1 (7-36)-Lys(biotin), amide, human
  • HomePage | About Us | Member Companies | Advertising | Contact us | Previous WebSite | MSDS | CAS Index | CAS DataBase | Privacy | Terms
  • All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.
    According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.
  • Copyright © 2023 ChemicalBook All rights reserved.