|
|
| | Glucagon-like peptide 1 (7-36)-Lys(biotin), amide, human Basic information |
| Product Name: | Glucagon-like peptide 1 (7-36)-Lys(biotin), amide, human | | Synonyms: | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRK(BIOTIN)-NH2;H-HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-LYS(BIOTIN)-NH2;GLP-1 (7-36)-Lys(Biotin), amide, human;Preproglucagon (78-107)-Lys(Biotin), amide, human;Glucagon-like peptide 1 (7-36)-Lys(biotin), amide, human | | CAS: | | | MF: | | | MW: | 0 | | EINECS: | | | Product Categories: | peptide | | Mol File: | Mol File | ![Glucagon-like peptide 1 (7-36)-Lys(biotin), amide, human Structure]() |
| | Glucagon-like peptide 1 (7-36)-Lys(biotin), amide, human Chemical Properties |
| | Glucagon-like peptide 1 (7-36)-Lys(biotin), amide, human Usage And Synthesis |
| | Glucagon-like peptide 1 (7-36)-Lys(biotin), amide, human Preparation Products And Raw materials |
|