195262-56-7(GLP-2 (RAT))

195262-56-7 Basic information More..

Product Name:	GLP-2 (RAT)
Synonyms:	GLUCAGON-LIKE PEPTIDE 2 (RAT);GLUCAGON-LIKE PEPTIDE II RAT;GLP-2 (RAT);H-HIS-ALA-ASP-GLY-SER-PHE-SER-ASP-GLU-MET-ASN-THR-ILE-LEU-ASP-ASN-LEU-ALA-THR-ARG-ASP-PHE-ILE-ASN-TRP-LEU-ILE-GLN-THR-LYS-ILE-THR-ASP-OH;HADGSFSDEMNTILDNLATRDFINWLIQTKITD;PREPROGLUCAGON (146-178) (RAT);PROGLUCAGON (126-158) (RAT);M.W. 3796.17 C166H256N44O56S
CAS:	195262-56-7
MF:	C166H256N44O56S
MW:	3796.13504
EINECS:
Mol File:	Mol File

Information Error Report

Your Email:

Browse by Nationality 195262-56-7 Suppliers

Germany(3)	United States(9)	Member(6)	All(13)
United Kingdom(1)

195262-56-7 Recommend Suppliers

Recommend You Select Member Companies.

Company Name:	Alfa Chemistry Recommend Complaint
Tel:	+1-5166625404;
Email:	Info@alfa-chemistry.com
Nationality:	United States
Products Intro:	Product Name:Glp-2(rat) CAS:195262-56-7 Purity:98.04%
CB Index:	58
WebSite:	https://www.alfa-chemistry.com/
Related Information:	Sales Network Catalog(20000) User Evaluation

Company Name:	BOC Sciences Recommend Complaint
Tel:	16314854226; +8616314854226
Email:	inquiry@bocsci.com
Nationality:	United States
Products Intro:	Product Name:GLP-2 (rat) CAS:195262-56-7 Purity:>=95% Remarks:Please reach out to us for more information about custom solutions.
CB Index:	58
WebSite:	https://www.bocsci.com/
Related Information:	Sales Network Catalog(19852) User Evaluation

Company Name:	Aladdin Scientific Recommend Complaint
Tel:
Email:	tp@aladdinsci.com
Nationality:	United States
Products Intro:	Product Name:GLP-2 (RAT) CAS:195262-56-7 Purity:>=95% Package:$508.9/500μg;$846.9/1mg;$1905.9/2.5mg;Bulk package Remarks:95%
CB Index:	58
WebSite:	www.aladdinsci.com/
Related Information:	Sales Network Catalog(50089) User Evaluation

Company Name:	ApexBio Technology Recommend Complaint
Tel:	+ 1-832-696-8203
Email:	sales@apexbt.com
Nationality:	United States
Products Intro:	Product Name:GLP-2 (rat) CAS:195262-56-7
CB Index:	58
WebSite:	www.apexbt.com
Related Information:	Sales Network Catalog(6245) User Evaluation

Company Name:	MedChemExpress Recommend Complaint
Tel:	021-58955995
Email:	sales@medchemexpress.com
Nationality:	United States
Products Intro:	Product Name:GLP-2(rat) CAS:195262-56-7
CB Index:	58
WebSite:	www.medchemexpress.com
Related Information:	Sales Network Catalog(6387) User Evaluation

1 2

Tag: 195262-56-7

HomePage | About Us | Member Companies | Advertising | Contact us | Previous WebSite | MSDS | CAS Index | CAS DataBase | Privacy | Terms
All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.
According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.