NEUROPEPTIDE Y (13-36), HUMAN, RAT manufacturers
|
| | NEUROPEPTIDE Y (13-36), HUMAN, RAT Basic information |
| Product Name: | NEUROPEPTIDE Y (13-36), HUMAN, RAT | | Synonyms: | L-Pro-L-Ala-L-Glu-L-Asp-L-Met-L-Ala-L-Arg-L-Tyr-L-Tyr-L-Ser-L-Ala-L-Leu-L-Arg-L-His-L-Tyr-L-Ile-L-Asp(NH2)-L-Leu-L-Ile-L-Thr-L-Arg-L-Gln-L-Arg-L-Tyr-NH2;Neuropeptide Y(13-36)【rat】;TYR-PRO-SER-LYS-PRO-ASP-ASN-PRO-GLY-GLU-ASP-ALA-PRO-ALA-GLU-ASP-MET-ALA-ARG-TYR-TYR-SER-ALA-LEU-ARG-HIS-TYR-ILE-ASN-LEU-ILE-THR-ARG-GLN-ARG-TYR-NH2: YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2;REF DUPL: H-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2;H-PRO-ALA-GLU-ASP-MET-ALA-ARG-TYR-TYR-SER-ALA-LEU-ARG-HIS-TYR-ILE-ASN-LEU-ILE-THR-ARG-GLN-ARG-TYR-NH2;NPY (13-36) (HUMAN, RAT);NEUROPEPTIDE Y (13-36) HUMAN;NEUROPEPTIDE Y (13-36), HUMAN, RAT | | CAS: | 122341-40-6 | | MF: | C134H207N41O36S | | MW: | 3000.4 | | EINECS: | | | Product Categories: | Peptide | | Mol File: | 122341-40-6.mol |  |
| | NEUROPEPTIDE Y (13-36), HUMAN, RAT Chemical Properties |
| density | 1.49±0.1 g/cm3(Predicted) | | storage temp. | -15°C | | solubility | Soluble in DMSO | | form | Solid | | color | White to off-white | | Sequence | Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 |
| | NEUROPEPTIDE Y (13-36), HUMAN, RAT Usage And Synthesis |
| Uses | Neuropeptide Y (13-36), amide, human is a selectiveneuropeptide Y2 receptoragonist[1]. | | in vivo | Neuropeptide Y (13-36) (intraventricular injection; 25-3000 pmol) produces a dose-dependent increase (up to 14%; ED50 value of 0.3 nmol for overall effects and 0.97 nmol for the peak effects) in mean arterial blood pressure in the awake, unrestrained male rat without affecting heart rate. Central administration of porcine Neuropeptide Y (13-36) produces marked vasodepressor and bradycardic actions in the anaesthetized α-chloralose and in the awake unrestrained male rat[1].Neuropeptide Y (13-36) (intracerebroventricular injection; 50 ng; alone; injected 30 and 15 min before measurements) injected into nave mice impairs social novelty preference, but not sociability, and this effect is inhibited by the NPY Y2 receptor antagonist BIIE 0246[2]. | Animal Model: | Male ICR mice (age 4-7 weeks)[2] | | Dosage: | 50 ng/mouse | | Administration: | Intracerebroventricular injection | | Result: | Significantly decreased interaction time with the new stranger mouse in session 3 that NPY 13-36. |
| | IC 50 | NPY Y2 receptor | | References | [1] Aguirre JA, et al. Centrally injected neuropeptide Y (13-36) produces vasopressor effects and antagonizes the vasodepressor action of neuropeptide Y (1-36) in the awake male rat. Neurosci Lett. 1990 Oct 2;118(1):5-8. DOI:10.1016/0304-3940(90)90235-2 [2] Daiki Ueda, et al. Increase in neuropeptide Y activity impairs social behaviour in association with glutamatergic dysregulation in diabetic mice. Br J Pharmacol. 2021 Feb;178(3):726-740. DOI:10.1111/bph.15326 |
| | NEUROPEPTIDE Y (13-36), HUMAN, RAT Preparation Products And Raw materials |
|