Product Categories
| Country: | China |
|---|---|
| Tel: | 21-21-61263452 |
| Mobile: | 13641803416 |
| E-mail: | ymbetter@glbiochem.com |
| QQ: | 3346126642 |
| Skype: | Chat Now! |
| Company Name: | Shanghai GL Peptide Ltd |
| Tel: | 86-21-61263385 |
| Fax: | 86-21-61263399 |
| Email: | ymbetter@glbiochem |
| WebSite: | http://www.glbiochem.com |
| Nationality: | CHINA |
| Product Name | MF | CAS | Details |
|---|
| P34cdc2 Kinase Fragment | Details |
| PAKtide??;RRRLSFAEPG | Details |
| Osteocalcin (7-19), human;GAPVPYPDPLEPR | C65H98N16O19 | 120944-72-1 | Details |
| Protein Kinase C: gamma Peptide | C69H115N19O22S2 | Details |
| Pancreatic Polypeptide, rat;APLEPMYPGDYATHEQRAQYETQLRRYINTLTRPRY-NH2 | C195H298N58O57S1 | 90419-12-8 | Details |
| Neurotensin (8-13);RRPYIL | C38H64N12O8 | 60482-95-3 | Details |
| Nitric Oxide Synthase (724-739) Blocking Peptide, Rat Brain | Details |
| Prepro-Atrial Natriuretic Factor (56-92) (human) | C31H32N4O2 | 112199-06-1 | Details |
| Proinsulin C-Peptide (31-63), porcine;RREAENPQAGAVELGGGLGGLQALALEGPPQKR | C142H239N47O46 | Details |
| Neurotensin: 1-6 | C35H52N8O12 | 87620-09-5 | Details |
| Ac-Neurotensin (8-13);Ac-RRPYIL | C40H66N12O9 | 74853-69-3 | Details |
| P1 | C6H12NO4PS2 | 2540-82-1 | Details |
| Orn8, Urotensin II, human | C63H83N13O18S2 | Details |
| NS2(114-121), Influenza??;RTFSFQLI | Details |
| Présure. 10. 145-148 | Details |
| Pep 4A;GSVVIVGRIILSGR-NH2 | C63H117N21O16 | Details |
| Protein Kinase C: 19-35 Peptide | C89H153N33O22 | Details |
| Parathyro?d Hormone(1-34), bovine | Details |
| P61 (343-355), M. leprae??;RVAQIRTEIENSD | Details |
| PDGFRtide | Details |
| Prepro TRH (83-106) | C115H176N34O45 | Details |
| Parathyroid Hormone: 69-84, human | C72H125N21O27 | Details |
| Pancreatic Polypeptide, avian | C190H283N53O58 | Details |
| Pro-Adrenomedullin: 45-92, human | Details |
| Orexin B, human;RSGPPGLQGRLQRLLQASGNHAAGILTM-NH2 | C123H212N44O35S | 205640-91-1 | Details |
| pTH (53-84) (human) | C149H252N42O55 | Details |
| Prepro-Atrial Natriuretic Factor (26-55) (human) | C152H236N38O51S3 | 112160-82-4 | Details |
| Osteogenic Growth Peptide | C68H110N22O18 | 132996-61-3 | Details |
| Proctolin;RYLPT | C32H52N8O10 | 100930-02-7 | Details |
| PACAP-Related Peptide (PRP), rat;DVAHEILNEAYRKVLDQLSARKYLQSMVA | C148H242N42O45S | Details |
| pTH (44-68) (human) | C117H199N41O41 | 64421-69-8 | Details |
| Pro-Adrenomedullin N20, rat;ARLDTSSQFRKKWNKWALSR-NH2 | C111H177N37O28 | Details |
| Protease - Activated Receptor - 4 | Details |
| Pancreatic Polypeptide (rana temporaria) | C192H276N52O58 | 132187-74-7 | Details |
| P38 (411-425), M. leprae??;AGGGVTLLQAAPALD | Details |
| Pannexin-1 Fragment (4515)??;EKNSRQRLLNPS | Details |
| P34cdc2 Peptide (PSTAIR) | C67H116N18O23 | Details |
| Pancreatic Polypeptide (31-36) Free Acid, human | C36H60N12O9 | Details |
| Neurotensin (1-11) | C66H99N19O18 | 74032-89-6 | Details |
| Octaneuropeptide | C41H74N12O11 | Details |
| Neurotensin (9-13) | C32H52N8O7 | Details |
| Osteocalcin (37-49), human;GFQEAYRRFYGPV | C75H104N20O19 | 89458-24-2 | Details |
| PAMP (1-20): Proadrenomedullin (1-20) human;ARLDVASEFRKKWNKWALSR-NH2 | C112H178N36O27 | 150238-87-2 | Details |
| Pro-Adrenomedullin N20, porcine;ARLDVAAEFRKKWNKWALSR-NH2 | C112H178N36O26 | Details |
| Nuclear Export Signal, NES, PKI??;ELALKLAGLDIN | Details |
| Properdistatin | Details |
| Parathyroid Hormone (1-34), rat;AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF | C180H291N55O48S2 | 98614-76-7 | Details |
| pp60(v-SRC) Autophosphorylation Site, Phosphorylated;RRLIEDNE-pY-TARG | C66H110N23O26P | Details |
| Nocistatin;EQKQLQ | C32H56N10O12 | Details |
| Pentagastrin | C37H49N7O9S | 5534-95-2 | Details |
| H-Gly-Gly-Tyr-Arg-OH | C19H29N7O6 | 70195-20-9 | Details |
| Orexin B[Lys29,30], canine | Details |
| Prosaptide 769P;CaFLVKEVTKLIDNNKTEKEIL | C114H194N28O35S | Details |
| GPHRSTPESRAAV;GPHRSTPESRAAV | C56H93N21O19 | Details |
| PKC (19-36): PKC Selective Inhibitor Protein;RFARKGALRQKNVHEVKN | C93H159N35O24 | 113731-96-7 | Details |
| Platelet-Derived Growth Factor Receptor Substrate 1: PDGF Receptor Substrate | Details |
| Prepro-CNP: 30-50, porcine, rat | C87H153N33O29 | Details |
| Protein Kinase C (alpha) Peptide | C66H114N24O24S | 159939-84-1 | Details |
| Non-beta-Amyloid Component of Alzheimer’s Disease (NAC);EQVTNVGGAVVTGVTAVAQKTVEGAGSIIAAATGFV | C141H235N39O49 | 154040-19-4 | Details |
| Pancreatic Polypeptide (1-17)-(Ala31,Aib32)-Neuropeptide Y (18-36) (human) | Details |
| PACAP-38 (28-38) (human, chicken, mouse, ovine, porcine, rat) | C61H110N24O14 | 160489-86-1 | Details |
| Pancreatic Polypeptide (bovine) | Details |
| p3K, (Lys 58 Lys 60 Lys 63) Ea(52–68)??;ASFEAQKAKANKAVDKA | Details |
| PAR-4 (1-6) amide (human) | Details |
| Parathyroid Hormone: 39-84, human | Details |
| Orexin B, mouse, rat;RPGPPGLQGRLQRLLQANGNHAAGILTM-NH2 | C126H215N45O34S | 202801-92-1 | Details |
| pTH (3-34) (bovine) | Details |
| Presenilin-2 N-Terminal Peptide | C65H103N23O30S | Details |
| Prosomatostatin (1-32), porcine | C161H260N44O45 | Details |
| PAR-4 (1-6) (human) | C28H41N7O9 | 225779-44-2 | Details |
| PKA Substrate;GRGLSLSR | C34H64N14O11 | 57836-10-9 | Details |
| Pancreastatin (33-49), porcine;QEEEEETAGAPQGLFRG-NH2 | C77H119N23O30 | 106507-61-3 | Details |
| PACAP-38: 16-38, human, ovine, rat | C123H215N39O28S | 144025-82-1 | Details |
| TRH-Gly | C18H24N6O6 | 85344-77-0 | Details |
| Pancreatic Polypeptide (human) | C185H287N53O54S2 | 75976-10-2 | Details |
| PD-145065 | C52H67N7O10 | 153049-49-1 | Details |
| pE-H-P-G-K | C24H36N8O7 | Details |
| Protease-Activated Receptor-4, PAR-4 Agonist, amide;GYPGKF-NH2 | C33H46N8O7 | 245443-52-1 | Details |
| NTB (Naltriben) | C50H65N11O11S2 | Details |
| Osteocalcin 30-43 Fragment | Details |
| Nitric Oxide Synthase (599-613) Blocking Peptide, Bovine Endothelial Cell | C85H127N25O27S | Details |
| Pneumadin (human) | C41H70N12O14 | 130918-91-1 | Details |
| Orexin B, canine | C125H214N44O34S1 | Details |
| PACAP-Related Peptide (PRP), human;DVAHGILNEAYRKVLDQLSAGKHLQSLVA | C139H229N41O42 | Details |
| pTH (70-84) (human) | C67H118N20O24 | 213533-86-9 | Details |
| Protein Kinase C (19-31) | C67H118N26O16 | 121545-65-1 | Details |
| PD 142893 | C50H65N7O10 | 155893-16-6 | Details |
| Non-?-Amyloid Component of Alzheimer's Disease: NAC | Details |
| Preptin (human) | Details |
| Pressinoic Acid | C33H42N8O10S2 | Details |
| Pancreastatin, porcine;GWPQAPAMDGAGKTGAEEAQPPEGKGAREHSRQEEEEETAGAPQGLFRG-NH2 | C214H330N68O76S | 106477-83-2 | Details |
| pTH (13-34) (human) | C125H199N39O33S | 81306-64-1 | Details |
| Parathyroid Hormone: 39-68, human | C139H234N46O46 | Details |
| Protein Kinase C: beta Peptide | C84H136N22O30S | Details |
| Pancreastatin (37-52), Human;EEEEEMAVVPQGLFRG-NH2 | C78H123N21O27S | 133605-57-9 | Details |
| p5 Ligand for Dnak and and DnaJ | Details |
| Parallel topology β - Amyloid modified peptide | Details |
| Pancreatic Polypeptide (31-36), amide, human | C36H61N13O8 | Details |
| PD-151242 | C34H45N5O6 | Details |
| PAR-4 (1-6) (mouse) | C33H45N7O8 | 213018-42-9 | Details |
| Product Total: Product Page: | ||||
| 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 | ||||