Vapreotide (trifluoroacetate salt)
|
- $95 - $149
- Product name: Vapreotide (trifluoroacetate salt)
- CAS:
- MF: C59H71F3N12O11S2
- MW: 1245.3940496
- EINECS:
- MDL Number:
- Synonyms:Vapreotide (trifluoroacetate salt)
2 prices
Selected condition：
Brand
- Cayman Chemical
Package
- 500μg
- 1mg
- ManufacturerCayman Chemical
- Product number24558
- Product descriptionVapreotide (trifluoroacetate salt) ≥95%
- Packaging500μg
- Price$95
- Updated2026-04-30
- Buy
- ManufacturerCayman Chemical
- Product number24558
- Product descriptionVapreotide (trifluoroacetate salt) ≥95%
- Packaging1mg
- Price$149
- Updated2026-04-30
- Buy
| Manufacturer | Product number | Product description | Packaging | Price | Updated | Buy |
|---|---|---|---|---|---|---|
| Cayman Chemical | 24558 | Vapreotide (trifluoroacetate salt) ≥95% | 500μg | $95 | 2026-04-30 | Buy |
| Cayman Chemical | 24558 | Vapreotide (trifluoroacetate salt) ≥95% | 1mg | $149 | 2026-04-30 | Buy |
Properties
solubility :Water: 1 mg/ml
Safety Information
| Symbol(GHS): | ||||||||
|---|---|---|---|---|---|---|---|---|
| Signal word: | ||||||||
| Hazard statements: |
|
|||||||
| Precautionary statements: |
|
Description
Vapreotide is a peptide neurokinin-1 receptor (NK1) antagonist and analog of somatostatin (IC50 = 330 nM in a radioligand binding assay).1 It inhibits increases in vascular permeability stimulated by substance P (Item No. 24035) in a concentration-dependent manner in isolated guinea pig trachea and main bronchi. Vapreotide (8 nmol per animal) reduces substance P-induced biting and scratching in mice. It increases reaction time to heat stimuli in the hot plate and tail flick tests when administered at a dose of 512 μg/kg, indicating antinociceptive activity in mice.2 Vapreotide reduces plasma growth hormone (GH) increases induced by phenobarbital (Item Nos. 9001494 | 20987), morphine (Item No. ISO60147), and chlorpromazine (Item No. 16129), hypoglycemia-induced glucagon elevation, and glucose-induced insulin secretion in rats.3 It also decreases tumor weight and volume in a hamster model of pancreatic ductal adenocarcinoma and suppresses tumor growth and reduces GH secretion in SK-ES-1 and MNNG/HOS osteosarcoma mouse xenograft models.4,5WARNING This product is not for human or veterinary use.More related product prices
FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2 STRESSCOPIN (3-40) (HUMAN) TRIFLUOROACETATE SALT