PANCREASTATIN, PORCINE
|
- $114 - $4122.8
- Product name: PANCREASTATIN, PORCINE
- CAS: 106477-83-2
- MF: C214H330N68O76S
- MW: 5103.385
- EINECS:
- MDL Number:MFCD00081805
- Synonyms:pancreastatin ;CHROMOGRANIN A (240-288) (PORCINE);GWPQAPAMDGAGKTGAEEAQPPEGKGAREHSRQEEEEETAGAPQGLFRG-NH2;GLY-TRP-PRO-GLN-ALA-PRO-ALA-MET-ASP-GLY-ALA-GLY-LYS-THR-GLY-ALA-GLU-GLU-ALA-GLN-PRO-PRO-GLU-GLY-LYS-GLY-ALA-ARG-GLU-HIS-SER-ARG-GLN-GLU-GLU-GLU-GLU-GLU-THR-ALA-GLY-ALA-PRO-GLN-GLY-LEU-PHE-ARG-GLY-;GLY-TRP-PRO-GLN-ALA-PRO-ALA-MET-ASP-GLY-ALA-GLY-LYS-THR-GLY-ALA-GLU-GLU-ALA-GLN-PRO-PRO-GLU-GLY-LYS-GLY-ALA-ARG-GLU-HIS-SER-ARG-GLN-GLU-GLU-GLU-GLU-GLU-THR-ALA-GLY-ALA-PRO-GLN-GLY-LEU-PHE-ARG-GLY-NH2;H-GLY-TRP-PRO-GLN-ALA-PRO-ALA-MET-ASP-GLY-ALA-GLY-LYS-THR-GLY-ALA-GLU-GLU-ALA-GLN-PRO-PRO-GLU-GLY-LYS-GLY-ALA-ARG-GLU-HIS-SER-ARG-GLN-GLU-GLU-GLU-GLU-GLU-THR-ALA-GLY-ALA-PRO-GLN-GLY-LEU-PHE-ARG-GLY-NH2;PANCREASTATIN (1-49) (PORCINE);PANCREASTATIN, PORCINE
20 prices
Selected condition:
Brand
- aablocks
- Arctom
- Biosynth
- ChemScene
- Thermo Scientific Chemicals
- Usbiological
Package
- 100ug
- 250ug
- 500ug
- 0.5mg
- 1mg
- 1000ug
- 2000ug
- 5mg
- 10mg
- Manufactureraablocks
- Product numberAA008RQN
- Product descriptionPancreastatin, Porcine >98%
- Packaging1mg
- Price$169
- Updated2026-05-28
- Buy
- Manufactureraablocks
- Product numberAA008RQN
- Product descriptionPancreastatin, Porcine >98%
- Packaging5mg
- Price$369
- Updated2026-05-28
- Buy
- Manufactureraablocks
- Product numberAA008RQN
- Product descriptionPancreastatin, Porcine >98%
- Packaging10mg
- Price$569
- Updated2026-05-28
- Buy
- ManufacturerArctom
- Product numberHY-P3863
- Product descriptionPancreastatin (swine) 97.65%
- Packaging5mg
- Price$285
- Updated2026-05-26
- Buy
- ManufacturerArctom
- Product numberHY-P3863
- Product descriptionPancreastatin (swine) 97.65%
- Packaging1mg
- Price$114
- Updated2026-05-26
- Buy
- ManufacturerArctom
- Product numberHY-P3863
- Product descriptionPancreastatin (swine) 97.65%
- Packaging10mg
- Price$456
- Updated2026-05-26
- Buy
- ManufacturerBiosynth
- Product numberFP109742
- Product descriptionPancreastatin (dephosphorylated) (porcine) trifluoroacetate salt
- Packaging100ug
- Price$900
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberFP109742
- Product descriptionPancreastatin (dephosphorylated) (porcine) trifluoroacetate salt
- Packaging250ug
- Price$900
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberFP109742
- Product descriptionPancreastatin (dephosphorylated) (porcine) trifluoroacetate salt
- Packaging500ug
- Price$900
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberPAN-3978-PI
- Product descriptionPancreastatin (Dephosphorylated Porcine)
- Packaging1mg
- Price$1031.87
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberFP109742
- Product descriptionPancreastatin (dephosphorylated) (porcine) trifluoroacetate salt
- Packaging1000ug
- Price$1320
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberFP109742
- Product descriptionPancreastatin (dephosphorylated) (porcine) trifluoroacetate salt
- Packaging2000ug
- Price$2320
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberPAN-3978-PI
- Product descriptionPancreastatin (Dephosphorylated Porcine)
- Packaging5mg
- Price$4122.8
- Updated2026-06-04
- Buy
- ManufacturerChemScene
- Product numberCS-0626278
- Product descriptionPancreastatin (swine) 97.65%
- Packaging10mg
- Price$520
- Updated2026-06-04
- Buy
- ManufacturerChemScene
- Product numberCS-0626278
- Product descriptionPancreastatin (swine) 97.65%
- Packaging1mg
- Price$130
- Updated2026-06-04
- Buy
- ManufacturerChemScene
- Product numberCS-0626278
- Product descriptionPancreastatin (swine) 97.65%
- Packaging5mg
- Price$325
- Updated2026-06-04
- Buy
| Manufacturer | Product number | Product description | Packaging | Price | Updated | Buy |
|---|---|---|---|---|---|---|
| aablocks | AA008RQN | Pancreastatin, Porcine >98% | 1mg | $169 | 2026-05-28 | Buy |
| aablocks | AA008RQN | Pancreastatin, Porcine >98% | 5mg | $369 | 2026-05-28 | Buy |
| aablocks | AA008RQN | Pancreastatin, Porcine >98% | 10mg | $569 | 2026-05-28 | Buy |
| Arctom | HY-P3863 | Pancreastatin (swine) 97.65% | 5mg | $285 | 2026-05-26 | Buy |
| Arctom | HY-P3863 | Pancreastatin (swine) 97.65% | 1mg | $114 | 2026-05-26 | Buy |
| Arctom | HY-P3863 | Pancreastatin (swine) 97.65% | 10mg | $456 | 2026-05-26 | Buy |
| Biosynth | FP109742 | Pancreastatin (dephosphorylated) (porcine) trifluoroacetate salt | 100ug | $900 | 2026-06-04 | Buy |
| Biosynth | FP109742 | Pancreastatin (dephosphorylated) (porcine) trifluoroacetate salt | 250ug | $900 | 2026-06-04 | Buy |
| Biosynth | FP109742 | Pancreastatin (dephosphorylated) (porcine) trifluoroacetate salt | 500ug | $900 | 2026-06-04 | Buy |
| Biosynth | PAN-3978-PI | Pancreastatin (Dephosphorylated Porcine) | 1mg | $1031.87 | 2026-06-04 | Buy |
| Biosynth | FP109742 | Pancreastatin (dephosphorylated) (porcine) trifluoroacetate salt | 1000ug | $1320 | 2026-06-04 | Buy |
| Biosynth | FP109742 | Pancreastatin (dephosphorylated) (porcine) trifluoroacetate salt | 2000ug | $2320 | 2026-06-04 | Buy |
| Biosynth | PAN-3978-PI | Pancreastatin (Dephosphorylated Porcine) | 5mg | $4122.8 | 2026-06-04 | Buy |
| ChemScene | CS-0626278 | Pancreastatin (swine) 97.65% | 10mg | $520 | 2026-06-04 | Buy |
| ChemScene | CS-0626278 | Pancreastatin (swine) 97.65% | 1mg | $130 | 2026-06-04 | Buy |
| ChemScene | CS-0626278 | Pancreastatin (swine) 97.65% | 5mg | $325 | 2026-06-04 | Buy |
Properties
storage temp. :-15°C
form :Solid
color :White to off-white
form :Solid
color :White to off-white
Safety Information
| Symbol(GHS): | ||||||||
|---|---|---|---|---|---|---|---|---|
| Signal word: | ||||||||
| Hazard statements: |
|
|||||||
| Precautionary statements: |
|
Description
Related product price
-
106507-61-3
$161-743.42 -
133605-57-9
$175-3150 -
15522-71-1
$18-982.81
Suppliers and manufacturers
GL Biochem (Shanghai) Ltd
Shanghai Hanhong Scientific Co.,Ltd.
Chemsky(shanghai)International Co.,Ltd.
Cellmano Biotech Limited
Nanjing Leon Biological Technology Co., Ltd.
Nanjing Peptide Biotech Ltd.
Chengdu Youngshe Chemical Co., Ltd.
Hangzhou Peptidego Biotech Co.,Ltd.
Nanjing Meihao Pharmaceutical Technology Co., Ltd.
Hangzhou Go Top Peptide Biotech




