ChemicalBook >> CAS DataBase List >>GLP-1 (7-37)

GLP-1 (7-37)

GLP-1 (7-37) structure

CAS No.: 106612-94-6

Chemical Name:: GLP-1 (7-37)

Synonyms: HuMan GLP-1;insulinotropin;7-37-Glucagon-likepeptide;HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-GLY;Tglp-1;GLP-1，GP;GLP-1, 7-37;Glp-I (7-37);GLP-1(7-37), >98%;Human GLP-1 (7-37)

CBNumber:: CB1445727

Molecular Formula:: C151H228N40O47

Molecular Weight:: 3355.67

MDL Number:: MFCD00167940

MOL File:: 106612-94-6.mol

MSDS File:: SDS

TDS File:: TDS

Last updated:2026-07-22 17:56:16

Product description	Number	Pack Size	Price
Glucagon-Like Peptide 1 Fragment 7-37 human ≥96% (HPLC)	G9416	0.5mg	$614
Glucagon-like Peptide 1 (Human 7-37)	PGP-4280-V	0.5mg	$1237.62
GLP-1(7-37) 99.89%	CS-5975	1mg	$152
GLP-1(7-37) 99.89%	CS-5975	5mg	$303
GLP-1(7-37) 99.89%	CS-5975	10mg	$455
More product size

Request For Quotation

GLP-1 (7-37) Properties

Density	1.48±0.1 g/cm3(Predicted)
storage temp.	−20°C
solubility	Water:30.0(Max Conc. mg/mL);8.34(Max Conc. mM)
form	Lyophilized powder
color	White to off-white
Water Solubility	Soluble in water at 2mg/ml
Sequence	H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH
InChIKey	GCYXWQUSHADNBF-AAEALURTSA-N
CAS DataBase Reference	106612-94-6
FDA UNII	PI470C66NT
UNSPSC Code	51111800
NACRES	NA.32

SAFETY

Risk and Safety Statements

PPE	Eyeshields, Gloves, type N95 (US)
Safety Statements	22-24/25
WGK Germany	3
Storage Class	11 - Combustible Solids

GLP-1 (7-37) price More Price(22)

Manufacturer	Product number	Product description	CAS number	Packaging	Price	Updated	Buy
Sigma-Aldrich	G9416	Glucagon-Like Peptide 1 Fragment 7-37 human ≥96% (HPLC)	106612-94-6	0.5mg	$614	2026-04-30	Buy
Biosynth	PGP-4280-V	Glucagon-like Peptide 1 (Human 7-37)	106612-94-6	0.5mg	$1237.62	2026-06-04	Buy
ChemScene	CS-5975	GLP-1(7-37) 99.89%	106612-94-6	1mg	$152	2026-06-04	Buy
ChemScene	CS-5975	GLP-1(7-37) 99.89%	106612-94-6	5mg	$303	2026-06-04	Buy
ChemScene	CS-5975	GLP-1(7-37) 99.89%	106612-94-6	10mg	$455	2026-06-04	Buy

Product number	Packaging	Price	Buy
G9416	0.5mg	$614	Buy
PGP-4280-V	0.5mg	$1237.62	Buy
CS-5975	1mg	$152	Buy
CS-5975	5mg	$303	Buy
CS-5975	10mg	$455	Buy

GLP-1 (7-37) Chemical Properties,Uses,Production

Description

GLP-1 (7-37) is an endogenous truncated form of GLP-1 that arises from proglucagon processing in intestinal endocrine L cells, GLP-1 (7-37) acts as a GLP-1 receptor agonist and is an insulinotropic hormone that augments glucose induced insulin secretion. GLP-1 (7-37) and derivatives GLP-1 (9-37) and GLP-1 (28-37) can reduce plaque inflammation and increase phenotypic characteristics of plaque stability in a murine model of atherosclerosis.

Uses

Glucagon-Like Peptide 1 Fragment 7-37 human has been used:

as a positive control for insulin secretion of pancreatic islets
to test its effect on insulin response in horse islets
in combination with mesenchymal stem cells (MSCs) test its protective effects in myocardial infarction

General Description

Glucagon-Like Peptide 1 Fragment 7-37 human (GLP-1-(7-37)) is an amino-truncated form of GLP-1.

Biochem/physiol Actions

Glucagon-Like Peptide 1 Fragment 7-37 human (GLP-1-(7-37)) interacts with the GLP-1 receptor (GLP-1r). It mediates insulin release by stimulating the cyclic AMP accumulation in islet cells GLP-l(7-37) is a potential therapeutic agent due to its insulin-secretagogue functionality.

in vitro

In vitro, truncated glucagon-like peptides [GLP-1(7-36)-amide and GLP-1(7-37)] increase insulin secretion in a glucose-dependent manner, and desensitization to the action of GLP-1(7-37) has been demonstrated acutely with high concentrations.

in vivo

GLP-1(7-37) (0.5, 5 or 50 pmol/min/kg) infused during the second hour of a 2-hour 11-mM hyperglycemic clamp produces a dose-related enhancement of the glucose-stimulated increase in plasma insulin concentration and an increased rate of glucose infusion in rats. Infusion of GLP-1(7-37) (5 pmol/min/kg) from 1 hour through 7 hours produces a sustained increase in plasma insulin concentration relative to levels in rats infused with vehicle in rats with maintained glucose concentration at 11 mM.

storage

Store at -20°C

GLP-1 (7-37) Preparation Products And Raw materials

Raw materials

Preparation Products

GLP-1 (7-37) Suppliers

Global( 228)Suppliers

Supplier	Tel	Email	Country	ProdList	Advantage
Cellmano Biotech Limited	0551-65326643 18156095617	info@cellmano.com	China	995	58
LEON (NANJING) BIOTECHNOLOGY CO., LTD.	15051830413	sales.njleonbiotech@gmail.com	China	5482	58
Yiwu Jingpinhui Plastic Co., Ltd.	+undefined19030790951	Admin@ywjinpinhui.com	China	299	58
EZM SCIENCES LIMITED	+undefined18218469372	ezmscience@pm.me	China	499	58
Hebei Dangtong Import and export Co LTD	+86-86-4001020630 +86-13910575315	admin@hbdangtong.com	China	996	58
Dingwang Technology (Wuhan) Co., Ltd.	+undefined-27-2786652399 +undefined13627115097	market02@senwayer.com	China	886	58
Hebei Jiafan Trading Company Limited	+86-15354498258;	sales01@jiafan88.com	China	207	58
Rongchuang International	+86-13175533356 +86-13175533356	kevin@rongchuangintl.com	China	256	58
Adachibio Inc.	+81-8027837258;	sales@adachibio.com	Japan	938	58
Henan Tianfu Chemical Co.,Ltd.	+86-0371-55170693 +86-19937530512	info@tianfuchem.com	China	21533	55

Supplier	Advantage
Cellmano Biotech Limited	58
LEON (NANJING) BIOTECHNOLOGY CO., LTD.	58
Yiwu Jingpinhui Plastic Co., Ltd.	58
EZM SCIENCES LIMITED	58
Hebei Dangtong Import and export Co LTD	58
Dingwang Technology (Wuhan) Co., Ltd.	58
Hebei Jiafan Trading Company Limited	58
Rongchuang International	58
Adachibio Inc.	58
Henan Tianfu Chemical Co.,Ltd.	55

View Lastest Price from GLP-1 (7-37) manufacturers

Update time	Product	Price	Min. Order	Purity	Supply Ability	Manufacturer
2026-08-19	GLP-1，GP-1,peptide 106612-94-6	$84.00	1BOX	99%	100000 BOX	Yiwu Jingpinhui Plastic Co., Ltd.
2026-08-19	GLP-1，GP-1,peptide 106612-94-6	$84.00	1BOX	99%	100000 BOX	Yiwu Jingpinhui Plastic Co., Ltd.
2026-08-19	GLP-1，GP-1 106612-94-6	$84.00	1BOX	99%	100000 BOX	Yiwu Jingpinhui Plastic Co., Ltd.

GLP-1，GP-1,peptide
106612-94-6
$84.00
99%
Yiwu Jingpinhui Plastic Co., Ltd.

GLP-1，GP-1,peptide
106612-94-6
$84.00
99%
Yiwu Jingpinhui Plastic Co., Ltd.

GLP-1，GP-1
106612-94-6
$84.00
99%
Yiwu Jingpinhui Plastic Co., Ltd.

106612-94-6(GLP-1 (7-37))Related Search:

Growth hormone releasing peptide GHRP-2 Sermorelin Nesiritide acetate Thymopentin

Triptorelin acetate Pramlintide acetate Eptifibatide Thymalfasin Glucagon

GLUCAGON-LIKE PEPTIDE I FRAGMENT 7-36 AMIDE HUMAN GLP-2（Glucagon-like peptide-2） GLP-1（Glucagon-like peptide-1）(7-36) GLP-1 (7-37) GLP-1 (9-36) AMIDE (HUMAN, BOVINE, GUINEA PIG, MOUSE, PORCINE, RAT)

AC-LEU-VAL-LYS-ALDEHYDE GLP-1+ FITC（Glucagon-like peptide-1）(7-36) ([125I]-TYR)-GLP-1 (7-37) (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT)

1of4

Insulinotropin (human) Peptide GLP-1 (human glucose-lowering peptide-1) Glp-I (7-37) Glucagon like peptide I (7-37) Glucagon-related peptide (oncorhynchus kisutch), 3-L-glutamic acid-6-L-phenylalanine-9-L-aspartic acid-12-L-serine-15-L-glutamic acid-16-glycine-21-L-isoleucine-24-L-alanine-27-L-valine-28-L-lysine-31-glycine- Tglp-1 GLP-1, 7-37 Preproglucagon 78-108 GLP-1 (7-37) (huMan, bovine, guinea pig, Mouse, rat) Proglucagon (78-108) (huMan, bovine, guinea pig, Mouse, rat), Insulinotropin (huMan, bovine, guinea pig, Mouse, rat), Glucagon-Like Peptide 1 (7-37) (huMan, bovine, guinea pig, Mouse, rat), Preproglucag 7-37-Glucagon-like peptide I (human) Human GLP-1 (7-37) GLP-1(7-38), Insulinotropin GLP-1, 7-37, Preproglucagon 78-108 Glucagon-Like Peptide (GLP) I (7-37) Proglucagon (78-108) (huMan, bovine, guinea pig, Mouse, rat), Insulinotropin (huMan, bovine, guinea pig, Mouse, rat), Glucagon-Like Peptide 1 (7-37) (huMan, bovine, guinea pig, Mouse, rat), Preproglucagon (98-128) (huMan, bovine, guinea pig, Mouse, rat) Proglucagon (78-108) (huMan, bovine, guinea pig, Mouse, rat), Glucagon-Like Peptide 1 (7-37) (huMan, bovine, guinea pig, Mouse, rat), Insulinotropin (huMan, bovine, guinea pig, Mouse, rat), Preproglucagon (98-128) (huMan, bovine, guinea pig, Mouse, rat) H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH acetate salt GLP-1 (7-37) Acetate | Glucagon-Like Peptide 1 l-L-lysyl-L-α-glutamyl-L-phenylalanyl-L-isoleucyl-L-alany PROGLUCAGON (78-108) (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) PREPROGLUCAGON 78-108 HUMAN PREPROGLUCAGON (98-128) (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) INSULINOTROPIN (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) H-HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-GLY-OH HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG GLP-1 (HUMAN, 7-37) (BOVINE, CANINE, RAT, GUINEA PIG) GLP-1 (7-37) (HUMAN) GLP-1 (7-37) (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) GLUCAGON-LIKE PEPTIDE 1 (HUMAN, 7-37) (BOVINE, CANINE, RAT, GUINEA PIG) GLUCAGON LIKE PEPTIDE-I (7-37), HUMAN GLUCAGON-LIKE PEPTIDE 1, FRAGMENT 7-37 HUMAN GLUCAGON-LIKE PEPTIDE 1 (7-37) GLUCAGON-LIKE PEPTIDE 1 (7-37) (HUMAN) GLUCAGON-LIKE PEPTIDE 1 (7-37) (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) GLP-1(7-37), >98% GLP-1(7-37),HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG, >98% GLP-1(7-37) impurity H-HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-GLY-OH USP/EP/BP H-HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GL... TIANFUCHEM--106612-94-6---H-HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-GLY-OH H-HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR- LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-LE-ALA-TRP-LEU-VAL- LYS-GLY-ARG-GLY-OH Insulinotropin acetate [GLP-1 (7-37) GLP-1 acetate salt Glucagon-Like Peptide-1 (7-37)|GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat) (5S,11S,14S,17S,20S,23S,26S,29S,32S,35S,38S,41S,44S,50S,53S,56S,59S,62S,65S,68S,71S,74S,77S,80S,86S)-20-((1H-Indol-3-yl)methyl)-86-((S)-2-((S)-2-amino-3-(1H-imidazol-5-yl)propanamido)propanamido)-44-(3-amino-3-oxopropyl)-11,35-bis(4-aminobutyl)-29,77-dibenzyl-26-((S)-sec-butyl)-32,50-bis(2-carboxyethyl)-68-(carboxymethyl)-5-(3-guanidinopropyl)-56-(4-hydroxybenzyl)-74,80-bis((R)-1-hydroxyethyl)-59,62,71-tris(hydroxymethyl)-17,53-diisobutyl-14,65-diisopropyl-23,38,41-trimethyl-4,7,10,13,16,19,22,2 Glucagon-Like Peptide 1, GLP-1 (7-37) human, mouse, rat, bovine, guinea pig GLP-1 (7-37), Human, Mouse, Rat, Bovine, Guinea Pig (5S,11S,14S,17S,20S,23S,26S,29S,32S,35S,38S,41S,44S,50S,53S,56S,59S,62S,65S,68S,71S,74S,77S,80S,86S)-20-((1H-Indol-3-yl)methyl)-86-((S)-2-((S)-2-amino-3-(1H-imidazol-5-yl)propanamido)propanamido)-44-(3-amino-3-oxopropyl)-11,35-bis(4-aminobutyl)-29,77-dibenzyl-26-((S)-sec-butyl)-32,50-bis(2-carboxyethyl)-68-(carboxymethyl)-5-(3-guanidinopropyl)-56-(4-hydroxybenzyl)-74,80-bis((R)-1-hydroxyethyl)-59,62,71-tris(hydroxymethyl)-17,53-diisobutyl-14,65-diisopropyl-23,38,41-trimethyl-4,7,10,13,16,19,22,25,28,31,34,37,40,43,46,49,52,55,58,61,64,67,70,73,76,79,82,85-octacosaoxo-3,6,9,12,15,18,21,24,27,30 7-37-Glucagon-likepeptide HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-GLY HuMan GLP-1 insulinotropin GLP-1，GP 106612-94-6 C151H228N40O47 peptides pharm peptide