ChemicalBook >> CAS DataBase List >>Teriparatide acetate

Teriparatide acetate

CAS No.
52232-67-4
Chemical Name:
Teriparatide acetate
Synonyms
PARATHYROID HORMONE (1-34), HUMAN;Parathar;hPTH (1-34);Teriparatid;Teroparatide;rHuPTH(1-34);CNV-38d(1-34);Teriparatide CRS;PTH (HUMAN, 1-34);Teriparatida(net)
CBNumber:
CB2284468
Molecular Formula:
C172H278N52O47S2
Molecular Weight:
3890.49792
MDL Number:
MFCD00149013
MOL File:
52232-67-4.mol
MSDS File:
SDS
TDS File:
TDS
Last updated:2026-09-11 16:58:12

Teriparatide acetate Properties

Melting point >205oC (dec.)
RTECS SQ7770000
storage temp. −20°C
solubility DMSO (Slightly), Water (Slightly)
form powder
color White to Off-White
biological source human
Water Solubility Soluble to 0.40 mg/ml in water
Sequence H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH
Stability Hygroscopic
InChIKey BUUKFBVDKSFMHN-LKMAISLMSA-N
CAS DataBase Reference 52232-67-4(CAS DataBase Reference)
FDA UNII 10T9CSU89I
UNSPSC Code 51111800
NACRES NA.77

SAFETY

Risk and Safety Statements

Symbol(GHS)  Exclamation Mark (GHS07)
GHS07
Signal word  Warning
Hazard statements  H302-H227
Precautionary statements  P210-P264-P270-P280-P301+P312-P330-P370+P378-P403+P235-P501
PPE Eyeshields, Gloves, type N95 (US)
WGK Germany  3
HS Code  2937190000
Storage Class 11 - Combustible Solids
Hazardous Substances Data 52232-67-4(Hazardous Substances Data)

Teriparatide acetate price More Price(61)

Manufacturer Product number Product description CAS number Packaging Price Updated Buy
Sigma-Aldrich Y0001916 Teriparatide European Pharmacopoeia (EP) Reference Standard 52232-67-4 1 mg $230 2026-04-30 Buy
Sigma-Aldrich P3796 Parathyroid Hormone Fragment 1-34 human ≥95% (HPLC), powder 52232-67-4 0.1mg $197 2026-04-30 Buy
Sigma-Aldrich Y0001895 Teriparatide for system suitability European Pharmacopoeia (EP) Reference Standard 52232-67-4 1.3 mg $252 2026-04-30 Buy
Sigma-Aldrich P3796 Parathyroid Hormone Fragment 1-34 human ≥95% (HPLC), powder 52232-67-4 0.5mg $299 2026-04-30 Buy
Sigma-Aldrich PHR8659 Teriparatide certified reference material, pharmaceutical secondary standard 52232-67-4 1MG $556 2026-04-30 Buy
Product number Packaging Price Buy
Y0001916 1 mg $230 Buy
P3796 0.1mg $197 Buy
Y0001895 1.3 mg $252 Buy
P3796 0.5mg $299 Buy
PHR8659 1MG $556 Buy

Teriparatide acetate Chemical Properties,Uses,Production

Application in Particular Diseases

In Osteoporosis:

  • Teriparatide is a recombinant product representing the first 34 amino acids in human parathyroid hormone. Teriparatide increases bone formation, the bone remodeling rate, and osteoblast number and activity. Both bone mass and architecture are improved.
  • Teriparatide is FDA approved for postmenopausal women and men who are at high risk for fracture. Candidates for therapy include patients with a history of osteoporotic fracture, multiple risk factors for fracture, very low bone density (e.g., T-score <–3.5), or those who have failed or are intolerant of previous bisphosphonate therapy.
  • The drug reduces fracture risk in postmenopausal women, but no fracture data are available in men. Lumbar spine BMD increases are higher than with any other osteoporosis therapy. Although wrist BMD is decreased, wrist fractures are not increased.
  • Discontinuation of therapy results in a decrease in BMD, but some antifracture efficacy appears to be maintained. Sequential therapy with teriparatide followed by an antiresorptive agent (e.g., bisphosphonate) should be considered to maintain BMD gains.
  • The dose is 20 mcg administered subcutaneously in the thigh or abdominal area (see Table 3-4). The initial dose should be given with the patient either lying or sitting, in case orthostatic hypotension occurs. Each prefilled 3-mL pen device delivers a 20-mcg dose each day for up to 28 days; the pen device should be kept refrigerated.
  • Transient hypercalcemia rarely occurs. A trough serum calcium concentration is recommended 1 month after initiation of therapy.
  • Teriparatide is contraindicated in patients at baseline increased risk for osteosarcoma (e.g., Paget’s bone disease, unexplained alkaline phosphatase elevations, pediatric patients, young adults with open epiphyses, or patients with prior radiation therapy involving the skeleton).

Description

The anabolic drug teriparatide acetate (TA), known as recombinant human parathyroid hormone 1–34, which directly promotes bone formation by generating new osteocytes, has been introduced as a novel therapeutic agent for osteoporosis. Distinct from antiresorptive drug treatment, patients with osteonecrosis of the jaw showed successful clinical outcomes after weekly administration of TA. In addition, adverse outcomes of long-term bisphosphonate treatment, such as bone fracture, were healed after usage of TA, and better bone mass and mineral density improvements at the lumbar spine and femoral neck were achieved with TA treatment than with bisphosphonate treatment[1].

Uses

A fragment of human parathyroid hormone (hPTH) peptide sequence containing the 34 N-terminal residues of hPTH. This fragment was also found to be an agonist at PTH1 and PTH2 receptors.

General Description

Teriparatide is a recombinantform of parathyroid hormone, which is used for the treatmentof osteoporosis in men and postmenopausal women.The N-terminal region possesses 34 amino acids, which areidentical to the biologically active region of the 84-aminoacid sequence of human parathyroid hormone. It has beenshown to act on osteoblasts to stimulate new bone growthand improve bone density.

Biological Activity

parathyroid hormone (1-34) (human), (c181h291n55o51s2), a peptide with the sequence h2n-svseiqlmhnlgkhlnsmervewlrkklqdvhnf-oh, mw= 4117.72. parathyroid hormone (pth), parathormone or parathyrin, is secreted by the chief cells of the parathyroid glands as a polypeptide containing 84 amino acids. it acts to increase the concentration of calcium (ca2+) in the blood, whereas calcitonin (a hormone produced by the parafollicular cells (c cells) of the thyroid gland) acts to decrease calcium concentration. pth acts to increase the concentration of calcium in the blood by acting upon the parathyroid hormone 1 receptor and the parathyroid hormone 2 receptor(1). parathyroid hormone regulates serum calcium, it enhances the release of calcium from the large reservoir contained in the bones(2). it enhances active reabsorption of calcium and magnesium from distal tubules and the thick ascending limb(3). it enhances the absorption of calcium in the intestine by increasing the production of activated vitamin d.figure1 formula of parathyroid hormone (1-34) (human)figure2 the parathyroid hormone (pth) system

Biochem/physiol Actions

Parathyroid hormone (PTH) is a parathyroid-secreted polypeptide hormone that increases the level of calcium in blood by enhancing calcium mobilization from bone, increasing the calcium:phosphate ratio in the kidney and promoting the absorption of calcium by the intestines. PTH is an anabolic agent that improves osteoblastic bone development. PTH 1-34 induces bone morphogenetic protein (BMP) gene transcription. Active N-terminal fragment of PTH (residues 1–34), has been used as a therapeutic for postmenopausal women with osteoporosis who are at high risk for fracture.

Mechanism of action

Teriparatide acetate is the salt form of teriparatide and has a similar mechanism of action to teriparatide. Teriparatide is a parathyroid hormone (PTH) analogue that regulates calcium and phosphate metabolism in bone and kidney by binding to the PTH type 1 receptor (PTH1R type) via the N-terminal portion. It has the same effect on calcium-phosphorus homeostasis as endogenous PTH (i.e., increases serum calcium and decreases serum phosphorus).

Pharmacokinetics

If administered once daily or intermittently, teriparatide preferentially enhances osteoblastic function,and bone formation occurs. Continuous exposure to endogenous PTH may result in poor skeletal composition because of enhanced osteoclast-mediated bone resorption. After 18 months of treatment, lumbar BMD increased up to 12% in postmenopausal women. After 10 months of treatment, 53% of men had an increase of 5% or greater in spine BMD. The risk for developing new vertebral fractures was reduced by 65% after 21 months of treatment, and the number of nonvertebral fragility fractures was reduced by 53%.

Clinical Use

In 2002, the U.S. FDA approved teriparatide for the treatment of postmenopausal osteoporosis in patients who have a high risk of fracture as well as to increase bone mass in men with primary or hypogonadal osteoporosis who have a high risk of fracture. Teriparatide is recombinant human PTH 1-34, the biologically active portion of the endogenously produced preprohormone. Unlike the bisphosphonates, which are classified as bone restorative agents, teriparatide is the first approved bone-forming agent. Bone formation is possible because of the ability of this agent to increase the number of osteoblasts. Although teriparatide enhances the function of both osteoclasts and osteoblasts, the exposure incidence dictates its effect on the skeleton.

Side effects

Temporary increases in serum calcium levels occur following administration of teriparatide. As a result, this agent is contraindicated in patients who are predisposed to hypercalcemia. Some evidence suggests that these elevations in serum calcium levels may cause a patient who is taking digitalis to experience digitalis toxicity (39). Teriparatide should not be prescribed to patients with Paget's disease, children, young adults, women who are pregnant or nursing, and those patients who have received skeletal radiation therapy. Because of an increased incidence of osteosarcoma (malignant bone tumors) observed in rats, teriparatide also carries a black box warning

storage

Store at -20°C

Dosage

Teriparatide acetate requires subcutaneous injection into the thigh or abdominal wall, and the recommended dose is 20 mcg once daily. If symptoms of orthostatic hypotension occur, it is administered while the patient is sitting or lying down. It is not recommended to use the drug for more than 2 years in the lifetime of the patient. Use teriparatide injection with caution in patients receiving digoxin. Transient hypercalcemia may predispose patients to digitalis toxicity.

Description

Parathyroid Hormone Human Synthetic (C181H291N55O51S2) contains 34 amino acids and has a molecular mass of 4117.72 Dalton.
The PTH is purified by proprietary chromatographic techniques.

Background

Parathyroid hormone (PTH), or parathormone, is secreted by the parathyroid glands as a polypeptide containing 84 amino acids. It acts to increase the concentration of calciumin the blood, whereas calcitonin (a hormone produced by the parafollicular cells of the thyroid gland) acts to decrease calcium concentration. PTH acts to increase the concentration of calcium in the blood by acting upon parathyroid hormone receptorin three parts of the body: In the bones- It enhances the release of calcium from the large reservoir contained in the bones. Bone resorption is the normal destruction of bone by osteoclasts, which are indirectly stimulated by PTH. Stimulation is indirect since osteoclasts do not have a receptor for PTH; rather, PTH binds to osteoblasts, the cells responsible for creating bone. Binding stimulates osteoblasts to increase their expression of RANKL, which can bind to osteoclast precursors containing RANK, a receptor for RANKL. The binding of RANKL to RANK stimulates these precursors to fuse, forming new osteoclasts which ultimately enhances the resorption of bone.
In the kidney- It enhances active reabsorption of calcium from distal tubules and the thick ascending limb.
In the intestine- It enhances the absorption of calcium in the intestine by increasing the production of vitamin D and upregulating the enzyme responsible for 1-alpha hydroxylationof 25-hydroxy vitamin D, converting vitamin D to its active form (1,25-dihydroxy vitamin D) which effects the actual absorption of calcium (as Ca2+ ions) by the intestine via calbindin.
Recombinant Human full length PTH 1-84 has potential as an anti-osteoporotic agent, due to its properties as a bone formation stimulant, it increases bone turnover, stimulating osteoblasts and reducing both vertebral and non vertebral fractures.

References

[1] Jeeho Sim. “Development of Clinical Weekly-Dose Teriparatide Acetate Encapsulated Dissolving Microneedle Patch for Efficient Treatment of Osteoporosis.” Polymers (2022).

Teriparatide acetate Preparation Products And Raw materials

Raw materials

Preparation Products

Global( 503)Suppliers
Supplier Tel Email Country ProdList Advantage
Chengdu Shengnuo Biopharm Co.,Ltd +86-13880038419 info@snbiopharm.com China 28 58
Shanghai Fine Biotech Co.,Ltd 18221172427; 18221172427 sale@fine-biotech.com China 227 58
Sichuan Jisheng Biopharmaceutical Co.,Ltd. +86-0833-2598983 +86-18086877136 Nyx-peptide@jsjpharm.cn China 287 58
Hangzhou Go Top Peptide Biotech 0571-88211921 13336126704 sales7@gotopbio.com China 2987 58
Shaoxing Junyu Biotechnology Co., LTD 0571-0571-88211921 19105816207 sales4@gotopbio.com China 5135 58
Sichuan Takele Biotechnology Co., Ltd. +86-028-64348587 15680781153 sales@takelepeptide.com China 66 58
Nanjing Yuanpeptide Biotech Co.,Ltd. 13357818155 linhui@yuan-peptide.com China 2901 58
Suzhou Tianma Pharma Group Tianji Bio-Pharmaceutical Co., Ltd. 0512-68322275 15850786624 danielzhao@tianmapharma.com China 30 58
Harbin Jixianglong Biotech Co., Ltd. 18246018015 1348764518@qq.com China 22 58
Pearl Biotechnology (Liaocheng City) Co., Ltd. 17763511183 2577248552@qq.com China 396 58

Related articles

View Lastest Price from Teriparatide acetate manufacturers

Image Update time Product Price Min. Order Purity Supply Ability Manufacturer
Teriparatide acetate pictures 2026-09-12 Teriparatide acetate
52232-67-4
$1.00 1g 99% 100kg RongNa Biotechnology Co.,Ltd
Teriparatide pictures 2026-09-11 Teriparatide
52232-67-4
$175.00-187.00 1kit 99.99% 1000000 kit Yiwu Qitai Trading Co., Ltd.
Teriparatide Acetate pictures 2026-09-11 Teriparatide Acetate
52232-67-4
$5.00 1Box 99.99% 20000 boxes Hebei Jiafan Trading Company Limited
  • Teriparatide pictures
  • Teriparatide
    52232-67-4
  • $175.00-187.00
  • 99.99%
  • Yiwu Qitai Trading Co., Ltd.

Teriparatide acetate Spectrum

PARATHYROID HORMONE HUMAN: FRAGMENT 1-34 PARATHYROID HORMONE (HUMAN, 1-34) PTH (1-34) (HUMAN) PTH (HUMAN, 1-34) Teriparatide acetate SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE HUMAN Pth(1-34)(human) Acetate Parathormone (1-34) [CYS5,28] PARATHYROID HORMONE (1-34), HUMAN [CYS5,28] PTH (1-34), HUMAN H-SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE-OH Parathyroid Hormone (PTH) (1-34), Human Teroparatide Teriparatide (Forteo) CNV-38d(1-34) Teriparatide, Teriparatida , Teriparatidum Teriparatide (PTH 1-34) PARATHYROID HORMONE FRAGMENT HUMAN 1-34 APPROX. 95% PARATHYROID HORMONE FRAGMENT HUMAN 1-34 90-95% Teriparatide, Parathyroid Hormone(1-34),human parathyroid hormone fragment 1-34 human PARATHYROID HORMONE (PTH) HUMAN 1-34, MIN 95% (1-34)-HUMAN PARATHYROID HORMONE Teriparatide, Parathyroid Hormone(1-34) ALA-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ALA-SER-VAL-GLU-ARG-MET-GLN-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE: AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF SER-VAL-SER-GLU-CYS-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-CYS-GLN-ASP-VAL-HIS-ASN-PHE Teriparatide acetate/HuMan PTH(1-34) M.W. 4117.72 C181H291N55O51S2 Parathyroid Hormone Fragment (1-34) H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH acetate salt hPTH (1-34) PTH 1-34;HPTH (1-34);HUMAN PARATHYROID HORMONE-(1-34) Pterospermum heterophyllum Hance. Parathyroid Hormone 1-34, Human - CAS 52232-67-4 - Calbiochem Teriparatide,PTH 1-34,hPTH (1-34),Human parathyroid hormone-(1-34), >99% Teriparatide CRS Teriparatide?Acetate impurity Teriparatide acetate USP/EP/BP Teriparatide,PTH 1-34,hPTH (1-34),Human parathyroid hormone-(1-34) Teriparatide Acetate/pTH(1-34) human Pteris formosana extract Teriparatide D10 AcetateQ: What is Teriparatide D10 Acetate Q: What is the CAS Number of Teriparatide D10 Acetate Q: What is the storage condition of Teriparatide D10 Acetate Q: What are the applications of Teriparatide D10 Acetate TeriparatideAcetateQ: What is TeriparatideAcetate Q: What is the CAS Number of TeriparatideAcetate Q: What is the storage condition of TeriparatideAcetate Q: What are the applications of TeriparatideAcetate Teriparatida(net) pTH (1-34) (human) Acetate(net) Teriparatide (COLD SHIPMENT REQUIRED) (1643962) Teriparatide (Y0001916) Teriparatide for system suitability (Y0001895) leriparatide acetate TeripaRatide Acetate peptide Terliparatide Acetate Teriparatide acetate Powder CNV-38d(1-34),Parathyroid Hormone (1-34), human Parathar Teriparatide Acetate(free base) Teriparatid