Welcome to chemicalbook!
China English Japan Germany
010-86108875
18162-48-6872-50-4Methylene ChloridenaphthaleneTHFTitanium Dioxide
Structure Search
RFQ
Try our best to find the right business for you.
Messages
Do not miss inquiry messages Please log in to view all inquiry messages.
My chemicalbook Sign in

Welcome back!

RFQ
skype
MY Account
Top
ChemicalBook >> CAS DataBase List >> Teriparatide acetate

Teriparatide acetate

Teriparatide acetate price.
  • $97 - $5690
  • Product name: Teriparatide acetate
  • CAS: 52232-67-4
  • MF: C172H278N52O47S2
  • MW: 3890.49792
  • EINECS:640-978-1
  • MDL Number:MFCD00149013
  • Synonyms:PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE HUMAN
Price60 Properties Safety Information Description
60 prices
Selected condition：
Brand
  • aablocks
  • American Custom Chemicals Corporation
  • ApexBio Technology
  • Arctom
  • Biosynth
  • Chemenu
  • ChemScene
  • Crysdot
  • DC Chemicals
  • Medical Isotopes, Inc.
  • Sigma-Aldrich
  • Thermo Scientific Chemicals
  • Tocris
  • TRC
  • Usbiological
Package
  • 23-5501-1mg
  • 0.5mg
  • 1mg
  • Y0001916
  • 0.1mg
  • 1
  • Y0001895
  • 2mg
  • 5mg
  • 10mg
  • 25mg
  • 50mg
  • 100mg
  • 250mg
  • 1g
  • 1 mg
  • 1.3 mg
  • Manufactureraablocks
  • Product numberAA01CBX8
  • Product descriptionTeriparatide >98%
  • Packaging1mg
  • Price$182
  • Updated2026-05-29
  • Buy
  • Manufactureraablocks
  • Product numberAA01CBX8
  • Product descriptionTeriparatide >98%
  • Packaging5mg
  • Price$255
  • Updated2026-05-29
  • Buy
  • Manufactureraablocks
  • Product numberAA01CBX8
  • Product descriptionTeriparatide >98%
  • Packaging10mg
  • Price$343
  • Updated2026-05-29
  • Buy
  • Manufactureraablocks
  • Product numberAA01CBX8
  • Product descriptionTeriparatide >98%
  • Packaging50mg
  • Price$651
  • Updated2026-05-29
  • Buy
  • Manufactureraablocks
  • Product numberAA01CBX8
  • Product descriptionTeriparatide >98%
  • Packaging100mg
  • Price$944
  • Updated2026-05-29
  • Buy
  • ManufacturerAmerican Custom Chemicals Corporation
  • Product numberSHG0006488
  • Product descriptionPARATHYROID HORMONE (1-34) 95.00%
  • Packaging1MG
  • Price$883.11
  • Updated2021-12-16
  • Buy
  • ManufacturerApexBio Technology
  • Product numberA1129
  • Product descriptionParathyroid hormone (1-34) (human)
  • Packaging25mg
  • Price$344
  • Updated2026-05-06
  • Buy
  • ManufacturerApexBio Technology
  • Product numberA1129
  • Product descriptionParathyroid hormone (1-34) (human)
  • Packaging5mg
  • Price$119
  • Updated2026-05-06
  • Buy
  • ManufacturerApexBio Technology
  • Product numberA1129
  • Product descriptionParathyroid hormone (1-34) (human)
  • Packaging1mg
  • Price$97
  • Updated2026-05-06
  • Buy
  • ManufacturerApexBio Technology
  • Product numberA1129
  • Product descriptionParathyroid hormone (1-34) (human)
  • Packaging10mg
  • Price$163
  • Updated2026-05-06
  • Buy
  • ManufacturerArctom
  • Product numberHY-P0059
  • Product descriptionTeriparatide 99.98%
  • Packaging1mg
  • Price$126
  • Updated2026-05-26
  • Buy
  • ManufacturerArctom
  • Product numberHY-P0059
  • Product descriptionTeriparatide 99.98%
  • Packaging5mg
  • Price$189
  • Updated2026-05-26
  • Buy
  • ManufacturerArctom
  • Product numberHY-P0059
  • Product descriptionTeriparatide 99.98%
  • Packaging10mg
  • Price$264
  • Updated2026-05-26
  • Buy
  • ManufacturerArctom
  • Product numberHY-P0059
  • Product descriptionTeriparatide 99.98%
  • Packaging100mg
  • Price$778
  • Updated2026-05-26
  • Buy
  • ManufacturerArctom
  • Product numberHY-P0059
  • Product descriptionTeriparatide 99.98%
  • Packaging50mg
  • Price$527
  • Updated2026-05-26
  • Buy
  • ManufacturerBiosynth
  • Product numberPP17066
  • Product descriptionParathyroid Hormone (1-34), human
  • Packaging1mg
  • Price$483.86
  • Updated2026-06-04
  • Buy
Manufacturer Product number Product description Packaging Price Updated Buy
aablocks AA01CBX8 Teriparatide >98% 1mg $182 2026-05-29 Buy
aablocks AA01CBX8 Teriparatide >98% 5mg $255 2026-05-29 Buy
aablocks AA01CBX8 Teriparatide >98% 10mg $343 2026-05-29 Buy
aablocks AA01CBX8 Teriparatide >98% 50mg $651 2026-05-29 Buy
aablocks AA01CBX8 Teriparatide >98% 100mg $944 2026-05-29 Buy
American Custom Chemicals Corporation SHG0006488 PARATHYROID HORMONE (1-34) 95.00% 1MG $883.11 2021-12-16 Buy
ApexBio Technology A1129 Parathyroid hormone (1-34) (human) 25mg $344 2026-05-06 Buy
ApexBio Technology A1129 Parathyroid hormone (1-34) (human) 5mg $119 2026-05-06 Buy
ApexBio Technology A1129 Parathyroid hormone (1-34) (human) 1mg $97 2026-05-06 Buy
ApexBio Technology A1129 Parathyroid hormone (1-34) (human) 10mg $163 2026-05-06 Buy
Arctom HY-P0059 Teriparatide 99.98% 1mg $126 2026-05-26 Buy
Arctom HY-P0059 Teriparatide 99.98% 5mg $189 2026-05-26 Buy
Arctom HY-P0059 Teriparatide 99.98% 10mg $264 2026-05-26 Buy
Arctom HY-P0059 Teriparatide 99.98% 100mg $778 2026-05-26 Buy
Arctom HY-P0059 Teriparatide 99.98% 50mg $527 2026-05-26 Buy
Biosynth PP17066 Parathyroid Hormone (1-34), human 1mg $483.86 2026-06-04 Buy
Next Last

Properties

Melting point :>205oC (dec.)
RTECS :SQ7770000
storage temp. :−20°C
solubility :DMSO (Slightly), Water (Slightly)
form :powder
color :White to Off-White
biological source :human
Water Solubility :Soluble to 0.40 mg/ml in water
Sequence :H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH
Stability :Hygroscopic
InChIKey :BUUKFBVDKSFMHN-LKMAISLMSA-N
CAS DataBase Reference :52232-67-4(CAS DataBase Reference)

Safety Information

Symbol(GHS): Exclamation Mark (GHS07)
Signal word: Warning
Hazard statements:
Code Hazard statements Hazard class Category Signal word Pictogram P-Codes
H227 Combustible liquid Flammable liquids Category 4 Warning P210, P280, P370+P378, P403+P235,P501
H302 Harmful if swallowed Acute toxicity,oral Category 4 Warning P264, P270, P301+P312, P330, P501
Precautionary statements:
P210 Keep away from heat/sparks/open flames/hot surfaces. — No smoking.
P264 Wash hands thoroughly after handling.
P264 Wash skin thouroughly after handling.
P270 Do not eat, drink or smoke when using this product.
P280 Wear protective gloves/protective clothing/eye protection/face protection.
P301+P312 IF SWALLOWED: call a POISON CENTER or doctor/physician IF you feel unwell.
P330 Rinse mouth.
P370+P378 In case of fire: Use … for extinction.
P403+P235 Store in a well-ventilated place. Keep cool.
P501 Dispose of contents/container to..…

Description

A fragment of human parathyroid hormone (hPTH) peptide sequence containing the 34 N-terminal residues of hPTH. This fragment was also found to be an agonist at PTH1 and PTH2 receptors.

More related product prices

Oxytocin Melanotan II Cosyntropin N-(N-(N-Glycylglycyl)glycyl)-8-L-lysinevasopressin Angiotensin acetate Pramlintide acetate Desmopressin Triptorelin acetate 86220-42-0 Ganirelix Leuprorelin acetate Eptifibatide Eledoisin VAPREOTIDE Leuprorelin 37025-55-1 Argipressine Tosylmethyl isocyanide

Related product price

Suppliers and manufacturers

Chengdu Shengnuo Biopharm Co.,Ltd Shanghai Fine Biotech Co.，Ltd Sichuan Jisheng Biopharmaceutical Co.,Ltd. Hangzhou Go Top Peptide Biotech Shaoxing Junyu Biotechnology Co., LTD Sichuan Takele Biotechnology Co., Ltd. Nanjing Yuanpeptide Biotech Co.，Ltd. Suzhou Tianma Pharma Group Tianji Bio-Pharmaceutical Co., Ltd. Harbin Jixianglong Biotech Co., Ltd. Pearl Biotechnology (Liaocheng City) Co., Ltd.