ChemicalBook >> CAS DataBase List >>H-His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2

H-His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2

CAS No.
99658-04-5
Chemical Name:
H-His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2
Synonyms
GLP-1, HUMAN;Glp-I (1-36)nh2;GLP-1 AMIDE (HUMAN);Glucagon-LikePeptide1amide;PREPROGLUCAGON 72-107 AMIDE;Glucagon-related peptide I(ox);GLP-1 (1-36) amide (human, rat);glucagon-like peptide I (1-36)amide;Glucagon-like peptide 1 (1-36)amide;GLUCAGON LIKE PEPTIDE-I AMIDE, HUMAN
CBNumber:
CB5209011
Molecular Formula:
C184H273N51O57
Molecular Weight:
4111.44392
MDL Number:
MFCD00081648
MOL File:
99658-04-5.mol
MSDS File:
SDS
TDS File:
TDS
Last updated:2026-09-12 18:53:18

H-His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 Properties

storage temp. −20°C
form Solid
Sequence His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2

SAFETY

Risk and Safety Statements

WGK Germany  3

H-His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 price More Price(18)

Manufacturer Product number Product description CAS number Packaging Price Updated Buy
Biosynth VAC-00469 Glucagon-Like Peptide 1, (GLP-1) amide, human 1mg $411.4 2026-06-05 Buy
Biosynth VAC-00469 Glucagon-Like Peptide 1, (GLP-1) amide, human 5mg $1234.2 2026-06-05 Buy
Biosynth VAC-00469 Glucagon-Like Peptide 1, (GLP-1) amide, human 10mg $2057 2026-06-05 Buy
Biosynth FG109695 GLP-1 (1-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt 99658-04-5 500ug $900 2026-06-04 Buy
Biosynth FG109695 GLP-1 (1-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt 99658-04-5 250ug $900 2026-06-04 Buy
Product number Packaging Price Buy
VAC-00469 1mg $411.4 Buy
VAC-00469 5mg $1234.2 Buy
VAC-00469 10mg $2057 Buy
FG109695 500ug $900 Buy
FG109695 250ug $900 Buy

H-His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 Chemical Properties, Uses, Production

Uses

GLP-1 (1-36) amide (human, rat) (Glucagon-like Peptide 1 (1-36) amide (human, rat) ) is a molecular variant of glucagon-like peptide 1 (GLP-1)-(7-36) amide. GLP-1 (1-36) amide (human, rat) can stimulate [14C]aminopyrine accumulation on enzymatically dispersed enriched rat parietal cells[1].

References

[1] Schmidtler J, Schepp W, Janczewska I, et al. GLP-1-(7-36) amide, -(1-37), and -(1-36) amide: potent cAMP-dependent stimuli of rat parietal cell function. Am J Physiol. 1991;260(6 Pt 1):G940-G950. DOI:10.1152/ajpgi.1991.260.6.G940

H-His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 Preparation Products And Raw materials

Raw materials

Preparation Products

H-His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 Suppliers

Global Suppliers ( 84)
Supplier Tel Email Country ProdList Advantage
GL Biochem (Shanghai) Ltd 21-61263452 13641803416 ymbetter@glbiochem.com China 9981 64
Shanghai Hanhong Scientific Co.,Ltd. 021-54306202 13764082696 info@hanhongsci.com China 42917 64
Chemsky(shanghai)International Co.,Ltd. 021-50135380 shchemsky@sina.com China 32273 50
Cellmano Biotech Limited 0551-65326643 18156095617 info@cellmano.com China 1010 55
Wuxi Zhongkun Biochemical Technology Co., Ltd. 0510-85629785 18013409632; sales@reading-chemicals.com China 15165 58
Hangzhou Peptide Biochem Co.,Ltd 0571-89197072; 18668118770 linda@peptide-china.com China 233 56
Creative Peptides info@creative-peptides.com United States 6083 56
Nanjing Leon Biological Technology Co., Ltd. 025-84523390 -127; 17705183659 sales@njleonbiotech.com China 5501 55
Nanjing Peptide Biotech Ltd. 025-58361106-805 15951641583 zhao.xu@njpeptide.com China 9976 55
Hangzhou Peptidego Biotech Co.,Ltd. 0571-87213919 15967184799 Eric@peptidego.com China 7872 58
PREPROGLUCAGON 72-107 AMIDE PREPROGLUCAGON (72-107), AMIDE, HUMAN PREPROGLUCAGON (92-127) AMIDE (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) TRIFLUOROACETATE SALT PROGLUCAGON (72-107) AMIDE (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) TRIFLUOROACETATE SALT HIS-ASP-GLU-PHE-GLU-ARG-HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-NH2 HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 GLUCAGON-LIKE PEPTIDE 1 (1-36) AMIDE (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) TRIFLUOROACETATE SALT GLUCAGON-LIKE PEPTIDE 1 AMIDE (HUMAN) GLUCAGON-LIKE PEPTIDE 1 (GLP-1) AMIDE, HUMAN GLUCAGON LIKE PEPTIDE-I AMIDE, HUMAN GLUCAGON-LIKE PEPTIDE I FRAGMENT 1-36 AMIDE HUMAN GLP-1 (1-36) AMIDE (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) TRIFLUOROACETATE SALT GLP-1, HUMAN GLP-1 AMIDE (HUMAN) Glucagon-LikePeptide1amide glucagon-like peptide I (1-36)amide Glucagon Like Peptide-I amide, human (GLP-1) GLP-1 (1-36) AMIDE (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) GLP-1 (1-36) aMide (huMan, bovine, guinea pig, Mouse, rat) Proglucagon (72-107) aMide (huMan, bovine, guinea pig, Mouse, rat), Glucagon-Like Peptide 1 (1-36) aMide (huMan, bovine, guinea pig, Mouse, rat), Preproglucagon (92-127) aMide (huMan, bovine, guin Proglucagon (72-107) aMide (huMan, bovine, guinea pig, Mouse, rat), Glucagon-Like Peptide 1 (1-36) aMide (huMan, bovine, guinea pig, Mouse, rat), Preproglucagon (92-127) aMide (huMan, bovine, guinea pig, Mouse, rat) Glucagon-like peptide 1 (1-36)amide Glucagon - Like Peptide 1, (GLP-1/GLP1) amide, human GLP-1 (1-36) amide (human, rat) GLP-1/Glucagon-Like Peptide, amide, human HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 Glp-I (1-36)nh2 L-Argininamide, L-histidyl-L-alpha-aspartyl-L-alpha-glutamyl-L-phenylalanyl-L-alpha-glutamyl-L-arginyl-L-histidyl-L-alanyl-L-alpha-glutamylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-alpha-aspartyl-L-valyl-L-seryl-L-seryl-L-tyrosyl-L-leucyl-L-alpha-glutamylglycyl-L-glutaminyl-L-alanyl-L-alanyl-L-lysyl-L-alpha-glutamyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-tryptophyl-L-leucyl-L-valyl-L-lysylglycyl- Glucagon-related peptide I(ox) H-HIS-ASP-GLU-PHE-GLU-ARG-HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-NH2 USP/EP/BP Glucagon-Like Peptide 1 (1-36) amide (human, bovin Glucagon-Like Peptide 1, GLP-1 (1-36) amide, human, mouse, rat, bovine, guinea pig - 0.5 mg H-His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 99658-04-5 C184H273N51O57 Biochemicals and Reagents Amino Acids and Peptides BioChemical GLP-1 Receptor Ligands Peptides Obesity Peptides peptide