Ac-RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS-NH2
|
- $343.75 - $5500
- Product name: Ac-RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS-NH2
- CAS: 475221-20-6
- MF: C206H324N56O65
- MW: 4625.11
- EINECS:
- MDL Number:MFCD06411437
- Synonyms:M.W. 4625.11 C206H324N56O65;NEP1-40;NOGO-66 (1-40);NOGO-66 (1-40) ANTAGONIST PEPTIDE;NOGO EXTRACELLULAR PEPTIDE, 1-40;PubChem ID: 90488731;NEP1-40; NOGO EXTRACELLULAR PEPTIDE; 1-40;Nogo Extracellular Peptide
13 prices
Selected condition:
Brand
- aablocks
- American Custom Chemicals Corporation
- ApexBio Technology
- Biosynth
- ChemScene
- Sigma-Aldrich
- Tocris
Package
- 1
- 1mg
- 5mg
- 10mg
- 100mg
- Manufactureraablocks
- Product numberAA00DDSB
- Product descriptionAC-RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS-NH2 >98%
- Packaging1mg
- Price$480
- Updated2026-05-28
- Buy
- Manufactureraablocks
- Product numberAA00DDSB
- Product descriptionAC-RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS-NH2 >98%
- Packaging5mg
- Price$1147
- Updated2026-05-28
- Buy
- Manufactureraablocks
- Product numberAA00DDSB
- Product descriptionAC-RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS-NH2 >98%
- Packaging10mg
- Price$1702
- Updated2026-05-28
- Buy
- ManufacturerAmerican Custom Chemicals Corporation
- Product numberPEP0003973
- Product descriptionNOGO-66(1-40) ANTAGONIST PEPTIDE 95.00%
- Packaging1MG
- Price$859.85
- Updated2021-12-16
- Buy
- ManufacturerApexBio Technology
- Product numberB5247
- Product descriptionNogo-66 (1-40)
- Packaging1mg
- Price$866
- Updated2026-05-06
- Buy
- ManufacturerBiosynth
- Product numberPP50250
- Product descriptionNEP(1-40)
- Packaging1mg
- Price$343.75
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberPP50250
- Product descriptionNEP(1-40)
- Packaging10mg
- Price$2062.5
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberPP50250
- Product descriptionNEP(1-40)
- Packaging100mg
- Price$5500
- Updated2026-06-04
- Buy
- ManufacturerChemScene
- Product numberCS-0029080
- Product descriptionNEP(1-40) 99.40%
- Packaging1mg
- Price$433
- Updated2026-06-04
- Buy
- ManufacturerChemScene
- Product numberCS-0029080
- Product descriptionNEP(1-40) 99.40%
- Packaging5mg
- Price$1083
- Updated2026-06-04
- Buy
- ManufacturerChemScene
- Product numberCS-0029080
- Product descriptionNEP(1-40) 99.40%
- Packaging10mg
- Price$1625
- Updated2026-06-04
- Buy
- ManufacturerSigma-Aldrich
- Product numberN7161
- Product descriptionNogo-66(1-40) antagonist peptide ≥84% (HPLC)
- Packaging1mg
- Price$637
- Updated2026-04-30
- Buy
- ManufacturerTocris
- Product number1984
- Product descriptionNogo-66(1-40)
- Packaging1
- Price$374
- Updated2021-12-16
- Buy
| Manufacturer | Product number | Product description | Packaging | Price | Updated | Buy |
|---|---|---|---|---|---|---|
| aablocks | AA00DDSB | AC-RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS-NH2 >98% | 1mg | $480 | 2026-05-28 | Buy |
| aablocks | AA00DDSB | AC-RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS-NH2 >98% | 5mg | $1147 | 2026-05-28 | Buy |
| aablocks | AA00DDSB | AC-RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS-NH2 >98% | 10mg | $1702 | 2026-05-28 | Buy |
| American Custom Chemicals Corporation | PEP0003973 | NOGO-66(1-40) ANTAGONIST PEPTIDE 95.00% | 1MG | $859.85 | 2021-12-16 | Buy |
| ApexBio Technology | B5247 | Nogo-66 (1-40) | 1mg | $866 | 2026-05-06 | Buy |
| Biosynth | PP50250 | NEP(1-40) | 1mg | $343.75 | 2026-06-04 | Buy |
| Biosynth | PP50250 | NEP(1-40) | 10mg | $2062.5 | 2026-06-04 | Buy |
| Biosynth | PP50250 | NEP(1-40) | 100mg | $5500 | 2026-06-04 | Buy |
| ChemScene | CS-0029080 | NEP(1-40) 99.40% | 1mg | $433 | 2026-06-04 | Buy |
| ChemScene | CS-0029080 | NEP(1-40) 99.40% | 5mg | $1083 | 2026-06-04 | Buy |
| ChemScene | CS-0029080 | NEP(1-40) 99.40% | 10mg | $1625 | 2026-06-04 | Buy |
| Sigma-Aldrich | N7161 | Nogo-66(1-40) antagonist peptide ≥84% (HPLC) | 1mg | $637 | 2026-04-30 | Buy |
| Tocris | 1984 | Nogo-66(1-40) | 1 | $374 | 2021-12-16 | Buy |
Properties
storage temp. :-20°C
solubility :H2O: 1 mg/mL
form :solid
color :white
Water Solubility :Soluble to 1 mg/ml in water
Sequence :Ac-Arg-Ile-Tyr-Lys-Gly-Val-Ile-Gln-Ala-Ile-Gln-Lys-Ser-Asp-Glu-Gly-His-Pro-Phe-Arg-Ala-Tyr-Leu-Glu-Ser-Glu-Val-Ala-Ile-Ser-Glu-Glu-Leu-Val-Gln-Lys-Tyr-Ser-Asn-Ser-NH2
solubility :H2O: 1 mg/mL
form :solid
color :white
Water Solubility :Soluble to 1 mg/ml in water
Sequence :Ac-Arg-Ile-Tyr-Lys-Gly-Val-Ile-Gln-Ala-Ile-Gln-Lys-Ser-Asp-Glu-Gly-His-Pro-Phe-Arg-Ala-Tyr-Leu-Glu-Ser-Glu-Val-Ala-Ile-Ser-Glu-Glu-Leu-Val-Gln-Lys-Tyr-Ser-Asn-Ser-NH2
Safety Information
| Symbol(GHS): | ||||||||
|---|---|---|---|---|---|---|---|---|
| Signal word: | ||||||||
| Hazard statements: |
|
|||||||
| Precautionary statements: |
|
Description
Nogo-66(1-40) antagonist peptide has been used as a Nogo-66 receptor antagonist peptide:- to study the preliminary therapeutic effect after inhibition of Nogo-A in the cauda equina compression (CEC) model
- to determine the effects of Nogo-A/NgR1 on autophagic activation
- to study its role in Nogo-B mediated axonal branching using Schwann cells and sensory neurons of mice
Related product price
-
AC-RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS-NH2
$343.75-5500 -
KRN7000
$110-6530.6 -
Arabic gum
$18.5-2750
Suppliers and manufacturers
3B Pharmachem (Wuhan) International Co.,Ltd.
Wuxi Zhongkun Biochemical Technology Co., Ltd.
Sigma-Aldrich
Creative Peptides
Shanghai YuanYe Biotechnology Co., Ltd.
Shanghai Chaolan Chemical Technology Center
Chengdu Youngshe Chemical Co., Ltd.
Hangzhou Peptidego Biotech Co.,Ltd.
BOC Sciences
Zhejiang J&C Biological Technology Co.,Limited




