GIP (HUMAN)
|
- $135 - $2119
- Product name: GIP (HUMAN)
- CAS: 100040-31-1
- MF: C226H338N60O66S
- MW: 4983.52932
- EINECS:
- MDL Number:MFCD00081634
- Synonyms:H-TYR-ALA-GLU-GLY-THR-PHE-ILE-SER-ASP-TYR-SER-ILE-ALA-MET-ASP-LYS-ILE-HIS-GLN-GLN-ASP-PHE-VAL-ASN-TRP-LEU-LEU-ALA-GLN-LYS-GLY-LYS-LYS-ASN-ASP-TRP-LYS-HIS-ASN-ILE-THR-GLN-OH;GLUCOSE-DEPENDENT INSULINOTROPIC POLYPEPTIDE (HUMAN);GASTRIC INHIBITORY PEPTIDE HUMAN;GASTRIC INHIBITORY POLYPEPTIDE (HUMAN);GIP (HUMAN);GIP;YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ;TYR-ALA-GLU-GLY-THR-PHE-ILE-SER-ASP-TYR-SER-ILE-ALA-MET-ASP-LYS-ILE-HIS-GLN-GLN-ASP-PHE-VAL-ASN-TRP-LEU-LEU-ALA-GLN-LYS-GLY-LYS-LYS-ASN-ASP-TRP-LYS-HIS-ASN-ILE-THR-GLN
24 prices
Selected condition:
Brand
- aablocks
- ApexBio Technology
- Arctom
- Biosynth
- ChemScene
- Sigma-Aldrich
- Thermo Scientific Chemicals
- Tocris
- Usbiological
Package
- 0.1mg
- .5mg
- .1mg
- 0.5mg
- 1
- 1mg
- 5mg
- 10mg
- 50ul
- 100ul
- Manufactureraablocks
- Product numberAA01EAXE
- Product descriptionGastric inhibitory polypeptide (human) 98%
- Packaging1mg
- Price$345
- Updated2026-05-30
- Buy
- Manufactureraablocks
- Product numberAA01EAXE
- Product descriptionGastric inhibitory polypeptide (human) ≥95%(HPLC)
- Packaging10mg
- Price$2119
- Updated2026-05-30
- Buy
- ManufacturerApexBio Technology
- Product numberB5255
- Product descriptionGIP (human)
- Packaging1mg
- Price$244
- Updated2026-05-06
- Buy
- ManufacturerArctom
- Product numberHY-P0276
- Product descriptionGIP, human 99.94%
- Packaging1mg
- Price$475
- Updated2026-05-26
- Buy
- ManufacturerArctom
- Product numberHY-P0276
- Product descriptionGIP, human 99.94%
- Packaging5mg
- Price$931
- Updated2026-05-26
- Buy
- ManufacturerBiosynth
- Product numberPGR-4178-S
- Product descriptionGIP (Human)
- Packaging0.1mg
- Price$515.15
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberCRB1000991
- Product descriptionGIP, human
- Packaging1mg
- Price$523.35
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberCRB1000991
- Product descriptionGIP, human
- Packaging0.5mg
- Price$331.46
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberPGR-4178-V
- Product descriptionGIP (Human)
- Packaging0.5mg
- Price$1733.92
- Updated2026-06-04
- Buy
- ManufacturerChemScene
- Product numberCS-7025
- Product descriptionGIP, human 99.94%
- Packaging1mg
- Price$542
- Updated2026-06-04
- Buy
- ManufacturerChemScene
- Product numberCS-7025
- Product descriptionGIP, human 99.94%
- Packaging5mg
- Price$1062
- Updated2026-06-04
- Buy
- ManufacturerSigma-Aldrich
- Product numberG2269
- Product descriptionGastric Inhibitory Polypeptide human ≥95% (HPLC)
- Packaging.5mg
- Price$1440
- Updated2022-05-15
- Buy
- ManufacturerSigma-Aldrich
- Product numberG2269
- Product descriptionGastric Inhibitory Polypeptide human ≥95% (HPLC)
- Packaging.1mg
- Price$358
- Updated2022-05-15
- Buy
- ManufacturerSigma-Aldrich
- Product numberG2269
- Product descriptionGastric Inhibitory Polypeptide human ≥95% (HPLC)
- Packaging0.5mg
- Price$1850
- Updated2026-04-30
- Buy
- ManufacturerSigma-Aldrich
- Product numberG2269
- Product descriptionGastric Inhibitory Polypeptide human ≥95% (HPLC)
- Packaging0.1mg
- Price$459
- Updated2026-04-30
- Buy
- ManufacturerThermo Scientific Chemicals
- Product numberJ66667
- Product descriptionGastric Inhibitory Peptide, human
- Packaging0.5mg
- Price$135
- Updated2021-12-16
- Buy
| Manufacturer | Product number | Product description | Packaging | Price | Updated | Buy |
|---|---|---|---|---|---|---|
| aablocks | AA01EAXE | Gastric inhibitory polypeptide (human) 98% | 1mg | $345 | 2026-05-30 | Buy |
| aablocks | AA01EAXE | Gastric inhibitory polypeptide (human) ≥95%(HPLC) | 10mg | $2119 | 2026-05-30 | Buy |
| ApexBio Technology | B5255 | GIP (human) | 1mg | $244 | 2026-05-06 | Buy |
| Arctom | HY-P0276 | GIP, human 99.94% | 1mg | $475 | 2026-05-26 | Buy |
| Arctom | HY-P0276 | GIP, human 99.94% | 5mg | $931 | 2026-05-26 | Buy |
| Biosynth | PGR-4178-S | GIP (Human) | 0.1mg | $515.15 | 2026-06-04 | Buy |
| Biosynth | CRB1000991 | GIP, human | 1mg | $523.35 | 2026-06-04 | Buy |
| Biosynth | CRB1000991 | GIP, human | 0.5mg | $331.46 | 2026-06-04 | Buy |
| Biosynth | PGR-4178-V | GIP (Human) | 0.5mg | $1733.92 | 2026-06-04 | Buy |
| ChemScene | CS-7025 | GIP, human 99.94% | 1mg | $542 | 2026-06-04 | Buy |
| ChemScene | CS-7025 | GIP, human 99.94% | 5mg | $1062 | 2026-06-04 | Buy |
| Sigma-Aldrich | G2269 | Gastric Inhibitory Polypeptide human ≥95% (HPLC) | .5mg | $1440 | 2022-05-15 | Buy |
| Sigma-Aldrich | G2269 | Gastric Inhibitory Polypeptide human ≥95% (HPLC) | .1mg | $358 | 2022-05-15 | Buy |
| Sigma-Aldrich | G2269 | Gastric Inhibitory Polypeptide human ≥95% (HPLC) | 0.5mg | $1850 | 2026-04-30 | Buy |
| Sigma-Aldrich | G2269 | Gastric Inhibitory Polypeptide human ≥95% (HPLC) | 0.1mg | $459 | 2026-04-30 | Buy |
| Thermo Scientific Chemicals | J66667 | Gastric Inhibitory Peptide, human | 0.5mg | $135 | 2021-12-16 | Buy |
Properties
storage temp. :−20°C
form :Solid
color :White to off-white
Water Solubility :Soluble to 1 mg/ml in water
Sequence :H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH
InChIKey :MGXWVYUBJRZYPE-YUGYIWNOSA-N
form :Solid
color :White to off-white
Water Solubility :Soluble to 1 mg/ml in water
Sequence :H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH
InChIKey :MGXWVYUBJRZYPE-YUGYIWNOSA-N
Safety Information
| Symbol(GHS): | ||||||||
|---|---|---|---|---|---|---|---|---|
| Signal word: | ||||||||
| Hazard statements: |
|
|||||||
| Precautionary statements: |
|
Description
GIP was originally isolated as a gastric inhibitory polypeptide. After the discovery of its glucose-dependent insulinotropic activity, known as the incretin effect, GIP was renamed glucose-dependent insulinotropic peptide.Gastric inhibitory peptide
Abbreviation: GIP
Additional names: gastric inhibitory polypeptide,gastrointestinal inhibitory peptide, glucose-dependent, insulinotropic peptide
Related product price
-
SALCOMINE
$6-4889.68 -
Aluminum acetylacetonate
$5-12900 -
Ethyl isocyanoacetate
$12.7-1687
Suppliers and manufacturers
3B Pharmachem (Wuhan) International Co.,Ltd.
GL Biochem (Shanghai) Ltd
Beijing Ouhe Technology Co., Ltd
Chemsky(shanghai)International Co.,Ltd.
Hunan Hui Bai Shi Biotechnology Co., Ltd.
Cellmano Biotech Limited
Shanghai Aladdin Bio-Chem Technology Co.,LTD
MedChemexpress LLC
Chengdu HuaXia Chemical Reagent Co. Ltd
Wuxi Zhongkun Biochemical Technology Co., Ltd.




