GLP-2 (HUMAN)
|
- $180 - $5880
- Product name: GLP-2 (HUMAN)
- CAS: 223460-79-5
- MF: C165H254N44O55S
- MW: 3766.10906
- EINECS:
- MDL Number:MFCD00081649
- Synonyms:PREPROGLUCAGON (146-179) (HUMAN) TRIFLUOROACETATE SALT;PREPROGLUCAGON (126-159) (HUMAN);PREPROGLUCAGON (146-178) (HUMAN);Glucagon-Like Peptide (GLP) II, human;HIS-ALA-ASP-GLY-SER-PHE-SER-ASP-GLU-MET-ASN-THR-ILE-LEU-ASP-ASN-LEU-ALA-ALA-ARG-ASP-PHE-ILE-ASN-TRP-LEU-ILE-GLN-THR-LYS-ILE-THR-ASP;H-HIS-ALA-ASP-GLY-SER-PHE-SER-ASP-GLU-MET-ASN-THR-ILE-LEU-ASP-ASN-LEU-ALA-ALA-ARG-ASP-PHE-ILE-ASN-TRP-LEU-ILE-GLN-THR-LYS-ILE-THR-ASP-ARG-OH;H-HIS-ALA-ASP-GLY-SER-PHE-SER-ASP-GLU-MET-ASN-THR-ILE-LEU-ASP-ASN-LEU-ALA-ALA-ARG-ASP-PHE-ILE-ASN-TRP-LEU-ILE-GLN-THR-LYS-ILE-THR-ASP-OH;HADGSFSDEMNTILDNLAARDFINWLIQTKITDR
32 prices
Selected condition:
Brand
- aablocks
- ApexBio Technology
- Arctom
- Biosynth
- ChemScene
- Tocris
- Usbiological
Package
- 0.5mg
- 500ug
- 1mg
- 1
- 1000ug
- 2000ug
- 5mg
- 5000ug
- 10mg
- 10000ug
- 25mg
- 50mg
- 200ul
- 48Tests
- 96Tests
- 500??g
- Manufactureraablocks
- Product numberAA01EAKD
- Product descriptionGlp-2(1-33)(Human) ≥98%
- Packaging1mg
- Price$320
- Updated2026-05-30
- Buy
- Manufactureraablocks
- Product numberAA01EAKD
- Product descriptionGlp-2(1-33)(Human) ≥98%
- Packaging5mg
- Price$1337
- Updated2026-05-30
- Buy
- Manufactureraablocks
- Product numberAA01EAKD
- Product descriptionGlp-2(1-33)(Human) ≥98%
- Packaging10mg
- Price$2058
- Updated2026-05-30
- Buy
- Manufactureraablocks
- Product numberAA01EAKD
- Product descriptionGlp-2(1-33)(Human) ≥98%
- Packaging25mg
- Price$4200
- Updated2026-05-30
- Buy
- Manufactureraablocks
- Product numberAA01EAKD
- Product descriptionGlp-2(1-33)(Human) ≥98%
- Packaging50mg
- Price$5880
- Updated2026-05-30
- Buy
- ManufacturerApexBio Technology
- Product numberB5281
- Product descriptionGLP-2 (human)
- Packaging5mg
- Price$1480
- Updated2026-05-06
- Buy
- ManufacturerApexBio Technology
- Product numberB5281
- Product descriptionGLP-2 (human)
- Packaging500ug
- Price$233
- Updated2026-05-06
- Buy
- ManufacturerApexBio Technology
- Product numberB5281
- Product descriptionGLP-2 (human)
- Packaging1mg
- Price$389
- Updated2026-05-06
- Buy
- ManufacturerArctom
- Product numberHY-P1024
- Product descriptionGLP-2(1-33)(human) 98.24%
- Packaging500??g
- Price$210
- Updated2026-05-26
- Buy
- ManufacturerArctom
- Product numberHY-P1024
- Product descriptionGLP-2(1-33)(human) 98.24%
- Packaging1mg
- Price$350
- Updated2026-05-26
- Buy
- ManufacturerArctom
- Product numberHY-P1024
- Product descriptionGLP-2(1-33)(human) 98.24%
- Packaging5mg
- Price$1048
- Updated2026-05-26
- Buy
- ManufacturerBiosynth
- Product numberVAC-00464
- Product descriptionGLP-2 (1-33) (human)
- Packaging5mg
- Price$1107.1
- Updated2026-06-05
- Buy
- ManufacturerBiosynth
- Product numberFG110245
- Product descriptionGLP-2 (1-33) (human) ammonium acetate salt
- Packaging2000ug
- Price$1020
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberPGL-4376-V
- Product descriptionGlucagon-like Peptide 2 (Human)
- Packaging0.5mg
- Price$1306.72
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberVAC-00464
- Product descriptionGLP-2 (1-33) (human)
- Packaging10mg
- Price$1845.3
- Updated2026-06-05
- Buy
- ManufacturerBiosynth
- Product numberFG110245
- Product descriptionGLP-2 (1-33) (human) ammonium acetate salt
- Packaging5000ug
- Price$2200
- Updated2026-06-04
- Buy
| Manufacturer | Product number | Product description | Packaging | Price | Updated | Buy |
|---|---|---|---|---|---|---|
| aablocks | AA01EAKD | Glp-2(1-33)(Human) ≥98% | 1mg | $320 | 2026-05-30 | Buy |
| aablocks | AA01EAKD | Glp-2(1-33)(Human) ≥98% | 5mg | $1337 | 2026-05-30 | Buy |
| aablocks | AA01EAKD | Glp-2(1-33)(Human) ≥98% | 10mg | $2058 | 2026-05-30 | Buy |
| aablocks | AA01EAKD | Glp-2(1-33)(Human) ≥98% | 25mg | $4200 | 2026-05-30 | Buy |
| aablocks | AA01EAKD | Glp-2(1-33)(Human) ≥98% | 50mg | $5880 | 2026-05-30 | Buy |
| ApexBio Technology | B5281 | GLP-2 (human) | 5mg | $1480 | 2026-05-06 | Buy |
| ApexBio Technology | B5281 | GLP-2 (human) | 500ug | $233 | 2026-05-06 | Buy |
| ApexBio Technology | B5281 | GLP-2 (human) | 1mg | $389 | 2026-05-06 | Buy |
| Arctom | HY-P1024 | GLP-2(1-33)(human) 98.24% | 500??g | $210 | 2026-05-26 | Buy |
| Arctom | HY-P1024 | GLP-2(1-33)(human) 98.24% | 1mg | $350 | 2026-05-26 | Buy |
| Arctom | HY-P1024 | GLP-2(1-33)(human) 98.24% | 5mg | $1048 | 2026-05-26 | Buy |
| Biosynth | VAC-00464 | GLP-2 (1-33) (human) | 5mg | $1107.1 | 2026-06-05 | Buy |
| Biosynth | FG110245 | GLP-2 (1-33) (human) ammonium acetate salt | 2000ug | $1020 | 2026-06-04 | Buy |
| Biosynth | PGL-4376-V | Glucagon-like Peptide 2 (Human) | 0.5mg | $1306.72 | 2026-06-04 | Buy |
| Biosynth | VAC-00464 | GLP-2 (1-33) (human) | 10mg | $1845.3 | 2026-06-05 | Buy |
| Biosynth | FG110245 | GLP-2 (1-33) (human) ammonium acetate salt | 5000ug | $2200 | 2026-06-04 | Buy |
Properties
storage temp. :−20°C
solubility :Soluble to 1 mg/ml in 5% NH4OH / water
form :solid
color :White to off-white
Water Solubility :Soluble to 1 mg/ml in 5% NH4OH / water
Sequence :H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH
solubility :Soluble to 1 mg/ml in 5% NH4OH / water
form :solid
color :White to off-white
Water Solubility :Soluble to 1 mg/ml in 5% NH4OH / water
Sequence :H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH
Safety Information
| Symbol(GHS): | ||||||||
|---|---|---|---|---|---|---|---|---|
| Signal word: | ||||||||
| Hazard statements: |
|
|||||||
| Precautionary statements: |
|
Description
GLP-2 is cosecreted with GLP-1 in response to nutrient ingestion. The principal role of GLP-2 appears to be the maintenance of the growth and absorptive function of the intestinal mucosal villus epithelium. GLP-2 was first identified as a novel peptide following the cloning of the proglucagon gene in the early 1980s, and subsequently the biosynthesis and release of GLP-2 were confirmed by isolation and characterization from the porcine and human small intestine. The biological role of GLP-2 as a stimulator of intestinal epithelial proliferation was first demonstrated in 1996.Related product price
-
Ethyl isocyanoacetate
$12.7-1687 -
COBALT(II) ACETYLACETONATE
$43-1161 -
Aluminum acetylacetonate
$5-12900
Suppliers and manufacturers
3B Pharmachem (Wuhan) International Co.,Ltd.
Shanghai Hanhong Scientific Co.,Ltd.
Chemsky(shanghai)International Co.,Ltd.
Cellmano Biotech Limited
MedChemexpress LLC
Wuxi Zhongkun Biochemical Technology Co., Ltd.
Creative Peptides
Shanghai YuanYe Biotechnology Co., Ltd.
Nanjing Leon Biological Technology Co., Ltd.
Nanjing Peptide Biotech Ltd.




