HELODERMIN

HELODERMIN Suppliers list

Company Name:	Shenzhen Nexconn Pharmatechs Ltd
Tel:	+86-755-89396905 +86-15013857715
Email:	admin@nexconn.com
Products Intro:	Product Name:Helodormin CAS:89468-62-2 Purity:98% Package:1KG;10KG;50KG

Company Name:	BOC Sciences
Tel:	+1-631-485-4226
Email:	inquiry@bocsci.com
Products Intro:	Product Name:Helodermin CAS:89468-62-2 Remarks:Reach out to us for more information about custom solutions.

Company Name:	Career Henan Chemica Co
Tel:	+86-0371-86658258 +8613203830695
Email:	laboratory@coreychem.com
Products Intro:	Product Name:HELODERMIN CAS:89468-62-2 Purity:99% Package:1KG;7USD

Company Name:	Zhejiang J&C Biological Technology Co.,Limited
Tel:	+1-2135480471 +1-2135480471;
Email:	sales@sarms4muscle.com
Products Intro:	CAS:89468-62-2 Purity:99% Package:5KG;1KG

HELODERMIN Basic information

Product Name:	HELODERMIN
Synonyms:	H-His-Ser-Asp-Ala-Ile-Phe-Thr-Glu-Glu-Tyr-Ser-Lys-Leu-Leu-Ala-Lys-Leu-Ala-Leu-Gln-Lys-Tyr-Leu-Ala-Ser-Ile-Leu-Gly-Ser-Arg-Thr-Ser-Pro-Pro-Pro-NH2;HIS-SER-ASP-ALA-ILE-PHE-THR-GLN-GLN-TYR-SER-LYS-LEU-LEU-ALA-LYS-LEU-ALA-LEU-GLN-LYS-TYR-LEU-ALA-SER-ILE-LEU-GLY-SER-ARG-THR-SER-PRO-PRO-PRO-NH2;H-HIS-SER-ASP-ALA-ILE-PHE-THR-GLN-GLN-TYR-SER-LYS-LEU-LEU-ALA-LYS-LEU-ALA-LEU-GLN-LYS-TYR-LEU-ALA-SER-ILE-LEU-GLY-SER-ARG-THR-SER-PRO-PRO-PRO-NH2;H-HIS-SER-ASP-ALA-ILE-PHE-THR-GLU-GLU-TYR-SER-LYS-LEU-LEU-ALA-LYS-ALA-LEU-GLN-LYS-TYR-LEU-ALA-SER-ILE-LEU-GLY-SER-ARG-THR-SER-PRO-PRO-PRO-NH2;HELODERMIN;HELODERMIN (HELODERMA SUSPECTUM);HELODORMIN;HSDAIFTGEYSKLLAKLALQKYLASILGSRTSPPP-NH2
CAS:	89468-62-2
MF:	C176H285N47O49
MW:	3843.43
EINECS:
Product Categories:	Peptides for Cell Biology;Signal TransductionPeptides for Cell Biology;Peptide;Vasoactive Intestinal Peptides;Vasoactive Intestinal PeptidesPeptides and Proteins;Vasoactive Intestinal PeptidesPeptides for Cell Biology;Application Index;Cell Signaling Enzymes;Gastrointestinal Peptides;Neuropeptides
Mol File:	89468-62-2.mol

HELODERMIN Chemical Properties

storage temp.	−20°C
form	ethanol solution
Sequence	His-Ser-Asp-Ala-Ile-Phe-Thr-Gln-Gln-Tyr-Ser-Lys-Leu-Leu-Ala-Lys-Leu-Ala-Leu-Gln-Lys-Tyr-Leu-Ala-Ser-Ile-Leu-Gly-Ser-Arg-Thr-Ser-Pro-Pro-Pro-NH2

Safety Information

Safety Statements	22-24/25
WGK Germany	3

MSDS Information

HELODERMIN Usage And Synthesis

Uses	Helodormin is a VIP-secretin-like peptide isolated from the venom of the Mexican monster lizard (Heloderma suspectum). Helodormin affects a variety of cellular functions by modulating intracellular signaling through activation of adenylate cyclase. Helodormin can be used to study the evolution and function of the secretin and VIP peptide families[1].
References	[1] Hoshino M, et al. Primary structure of helodermin, a VIP-secretin-like peptide isolated from Gila monster venom[J]. FEBS letters, 1984, 178(2): 233-239. DOI:10.1016/0014-5793(84)80607-9

HELODERMIN Preparation Products And Raw materials

Tag:HELODERMIN(89468-62-2) Related Product Information

MAS 7 MU-CONOTOXIN GIIIA Polistes mastoparan MASTOPARAN 17 3':5'-CYCLIC-NUCLEOTIDE 5'-NUCLEOTIDOHYDROLASE ECHISTATIN PHOSPHOLIPASE A2 Desacetylcinobufagin 19-Hydroxybufalin Vasoactive Intestinal Peptide (VIP-PHI Like Peptide) (Helodermin) (Heloderma suspectum) HELODERMIN (GLU8,9)-HELODERMIN [GLN8, GLN9] HELODERMIN helodermin (1-28) amide HELODERMIN POLYCLONAL ANTIBODY HELODERMIN,RABBITANTI-LIZARDGILAMONSTER:RIA helodermin receptor [GLN8,9]-HELODERMIN

HomePage | Member Companies | Advertising | Contact us | Previous WebSite | MSDS | CAS Index | CAS DataBase | Privacy | Terms | About Us
All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.
According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

Login