GALANIN MESSAGE ASSOCIATED PEPTIDE (1-41) AMIDE
| Price | $7 |
| Package | 1KG |
| Min. Order: | 1KG |
| Supply Ability: | 100kg |
| Update Time: | 2020-02-14 |
Product Details
| Product Name: GALANIN MESSAGE ASSOCIATED PEPTIDE (1-41) AMIDE | CAS No.: 132699-74-2 |
| Min. Order: 1KG | Purity: 99% |
| Supply Ability: 100kg | Release date: 2020/02/14 |
| Name: Judy Liang |
Product Name: GALANIN MESSAGE ASSOCIATED PEPTIDE (1-41) AMIDE
Synonyms: H-GLU-LEU-GLU-PRO-GLU-ASP-GLU-ALA-ARG-PRO-GLY-GLY-PHE-ASP-ARG-LEU-GLN-SER-GLU-ASP-LYS-ALA-ILE-ARG-THR-ILE-MET-GLU-PHE-LEU-ALA-PHE-LEU-HIS-LEU-LYS-GLU-ALA-GLY-ALA-LEU-NH2;GMAP (1-41) AMIDE;GALANIN MESSAGE ASSOCIATED PEPTIDE FRAGMENT 1-41 AMIDE PORCINE;GALANIN MESSAGE ASSOCIATED PEPTIDE (1-41) AMIDE;ELEPEDEARPGGFDRLQSEDKAIRTIMEFLAFLHLKEAGAL-NH2;PREPROGALANIN (65-105) AMIDE;PREPROGALANIN-NH2 (65-105);galanin message associated peptide,*fragment 1-41
CAS: 132699-74-2
MF: C206H326N56O64S1
MW: 4643.19
EINECS:
Product Categories: peptide
Mol File: Mol File
GALANIN MESSAGE ASSOCIATED PEPTIDE (1-41) AMIDE Structure
GALANIN MESSAGE ASSOCIATED PEPTIDE (1-41) AMIDE Chemical Properties
storage temp. −20°C
Safety Information
WGK Germany 3
MSDS Information
Provider Language
SigmaAldrich English
GALANIN MESSAGE ASSOCIATED PEPTIDE (1-41) AMIDE Usage And Synthesis
GALANIN MESSAGE ASSOCIATED PEPTIDE (1-41) AMIDE Preparation Products And Raw materials
Company Profile Introduction
Established in 2014,Career Henan Chemical Co. is a manufacturerspecializing in the sale of fine chemicals.
Mainly deals in the sales of:
Pharmaceutical intermediates
OLED intermediates:
Pharmaceutical intermediates;
OLED intermediates;
You may like
-
CAS: 128315-56-0
$7.00 / 1KG
Recommended supplier
| Product name | Price | Suppliers | Update time | |
|---|---|---|---|---|
| $30.00/1mg |
VIP4Y
|
TargetMol Chemicals Inc.
|
2025-10-23 | |
| $1000.00/1g |
VIP1Y
|
Chengdu Shengnuo Biopharm Co.,Ltd
|
2025-10-09 | |
| $75.00/1Box |
VIP1Y
|
Hebei Kenwei Packaging Products Co., LTD
|
2025-09-26 |
- Since: 2014-12-17
- Address: 702, Building 10, East District, National University Science and Technology Park, High tech Zone, Zh
INQUIRY

China