Welcome to chemicalbook!
+1 (818) 612-2111
RFQ
Try our best to find the right business for you.
Do not miss inquiry messages Please log in to view all inquiry messages.

Welcome back!

RFQ
skype
MY Account
Top
Postion:Product Catalog >API>Hormones and the Endocrine System>Pancreatic hormone and blood sugar regulation>Glucagon
Glucagon
  • Glucagon

Glucagon

Price Get Latest Price
Package 1kg 10kg 25kg
Min. Order: 1kg
Supply Ability: 1Ton
Update Time: 2025-04-04

Product Details

Product Name: Glucagon CAS No.: 16941-32-5
Min. Order: 1kg Purity: 98%
Supply Ability: 1Ton Release date: 2025/04/04

1. Product Information

 

Product Name:Glucagon
Synonyms:GLUCAGON 1-37;GLUCAGON (1-37) (PORCINE);GLUCAGON 37;GLUCAGON ACETATE;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH;Glucagon 1-29;Glucagon(1-29) Human HCl
CAS:16941-32-5
MF:C153H225N43O49S
MW:3482.75
EINECS:685-611-6
Product Categories:Amino Acid Derivatives;Peptide;GlucagonIslet  Stem  Cell  Biology;Islet  Stem  Cell  Differentiation;Hormones;Other  Protein/Peptide  Hormones;Glucagon  and  Glucagon-Like  PeptidesPeptides  for  Cell  Biology;GlucagonsIslet  Stem  Cell  Biology;Cytokines  Growth  Factors  and  Hormones  (Obesity);Gastrointestinal  Peptides;GlucagonObesity  Research;API;Diabetes Research
Mol File:16941-32-5.mol
Article illustration
Glucagon Basic informationDiscovery Structure Clinical implications Polypeptide hormone with straight-chain Pharmacological effects Indications Usage and dosage Side effects


2. Company information

Founded in 2014, Henan Aochuang Chemical Co., Ltd. is committed to the development of medical science and material chemistry technology. Based on the advanced technology for chemical and medical , it specializes in the research, development, and sales of pharmaceutical intermediates, electronic intermediates ,battery material intermediates, and other fine chemicals. The company has professionals who have been engaged in chemical production and sales for many years. It is a vigorous pharmaceutical chemical technology enterprise with professional background.

3. Contact information

For more information about the product, including package , specification, price ,shipment etc, pls contact us freely .

Email address : sales@aochuangchem.com

Telephone No.: +86-037163689365

Mob No.: +86 18638391208

 


Company Profile Introduction

Founded in 2014, Henan Aochuang Chemical Co., Ltd. is committed to the development of medical science and material chemistry technology. Based on the advanced technology for chemical and medical , it specializes in the research, development, and sales of pharmaceutical intermediates, electronic intermediates ,battery material intermediates, and other fine chemicals. The company has professionals who have been engaged in chemical production and sales for many years. It is a vigorous pharmaceutical chemical technology enterprise with professional background. 90% of the company's products are sold to Japan, South Korea, Europe and the United States. We have maintained good cooperative relations with many international well-known enterprises, and have been well received by all parties. ? Adhering to the principle of "quality first, customer first, integrity-based, mutual benefit", the company provides customers with high-quality products ranging from grams to tons, and comprehensive services from products to technology, and is willing to work together with all walks of life. , and jointly contribute to the development of the material and pharmaceutical industry!

Recommended supplier

Product name Price   Suppliers Update time
$0.00/1removed
VIP4Y
TargetMol Chemicals Inc.
2025-10-27
$1.00/1g
VIP1Y
Handan City Zechi trading Co., LTD
2025-09-11
$2.00/100kg
VIP1Y
ZHENGZHOU JIUYI TIME NEW MATERIALS CO,.LTD
2025-06-20
$0.00/1g
VIP2Y
Shaanxi Xianhe Biotech Co., Ltd
2025-04-14
$0.00/1kg
VIP1Y
Hebei Junhua Import and Export Co., LTD
2025-03-31
$30.00/1kg
Shandong Deshang Chemical Co., Ltd.
2024-07-10
$22.00/1box
Shanghai Getian Industrial Co., LTD
2024-05-11
$0.00/1g
VIP2Y
Shaanxi TNJONE Pharmaceutical Co., Ltd
2024-04-15
$30.00/1box
hebei hongtan Biotechnology Co., Ltd
2024-03-20
$70.00/1kg
VIP3Y
Zibo Hangyu Biotechnology Development Co., Ltd
2023-11-02
INQUIRY

18638391208
sales@aochuangchem.com