GIP (HUMAN)
|
- $135 - $2119
- Product name: GIP (HUMAN)
- CAS: 100040-31-1
- MF: C226H338N60O66S
- MW: 4983.52932
- EINECS:
- MDL Number:MFCD00081634
- Synonyms:H-TYR-ALA-GLU-GLY-THR-PHE-ILE-SER-ASP-TYR-SER-ILE-ALA-MET-ASP-LYS-ILE-HIS-GLN-GLN-ASP-PHE-VAL-ASN-TRP-LEU-LEU-ALA-GLN-LYS-GLY-LYS-LYS-ASN-ASP-TRP-LYS-HIS-ASN-ILE-THR-GLN-OH;GLUCOSE-DEPENDENT INSULINOTROPIC POLYPEPTIDE (HUMAN);GASTRIC INHIBITORY PEPTIDE HUMAN;GASTRIC INHIBITORY POLYPEPTIDE (HUMAN);GIP (HUMAN);GIP;YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ;TYR-ALA-GLU-GLY-THR-PHE-ILE-SER-ASP-TYR-SER-ILE-ALA-MET-ASP-LYS-ILE-HIS-GLN-GLN-ASP-PHE-VAL-ASN-TRP-LEU-LEU-ALA-GLN-LYS-GLY-LYS-LYS-ASN-ASP-TRP-LYS-HIS-ASN-ILE-THR-GLN
25 prices
Selected condition:
Brand
- aablocks
- ApexBio Technology
- Arctom
- Biosynth
- ChemScene
- Sigma-Aldrich
- Thermo Scientific Chemicals
- Tocris
- Usbiological
Package
- 0.1mg
- .5mg
- .1mg
- 0.5mg
- 1
- 1mg
- 5mg
- 10mg
- 50ul
- 100ul
- Manufactureraablocks
- Product numberAA01EAXE
- Product descriptionGastric inhibitory polypeptide (human) 98%
- Packaging1mg
- Price$345
- Updated2026-05-30
- Buy
- Manufactureraablocks
- Product numberAA01EAXE
- Product descriptionGastric inhibitory polypeptide (human) ≥95%(HPLC)
- Packaging10mg
- Price$2119
- Updated2026-05-30
- Buy
- ManufacturerApexBio Technology
- Product numberB5255
- Product descriptionGIP(human)
- Packaging1mg
- Price$520
- Updated2021-12-16
- Buy
- ManufacturerApexBio Technology
- Product numberB5255
- Product descriptionGIP (human)
- Packaging1mg
- Price$244
- Updated2026-05-06
- Buy
- ManufacturerArctom
- Product numberHY-P0276
- Product descriptionGIP, human 99.94%
- Packaging1mg
- Price$475
- Updated2026-05-26
- Buy
- ManufacturerArctom
- Product numberHY-P0276
- Product descriptionGIP, human 99.94%
- Packaging5mg
- Price$931
- Updated2026-05-26
- Buy
- ManufacturerBiosynth
- Product numberCRB1000991
- Product descriptionGIP, human
- Packaging1mg
- Price$523.35
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberPGR-4178-S
- Product descriptionGIP (Human)
- Packaging0.1mg
- Price$515.15
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberCRB1000991
- Product descriptionGIP, human
- Packaging0.5mg
- Price$331.46
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberPGR-4178-V
- Product descriptionGIP (Human)
- Packaging0.5mg
- Price$1733.92
- Updated2026-06-04
- Buy
- ManufacturerChemScene
- Product numberCS-7025
- Product descriptionGIP, human 99.94%
- Packaging1mg
- Price$542
- Updated2026-06-04
- Buy
- ManufacturerChemScene
- Product numberCS-7025
- Product descriptionGIP, human 99.94%
- Packaging5mg
- Price$1062
- Updated2026-06-04
- Buy
- ManufacturerSigma-Aldrich
- Product numberG2269
- Product descriptionGastric Inhibitory Polypeptide human ≥95% (HPLC)
- Packaging.5mg
- Price$1440
- Updated2022-05-15
- Buy
- ManufacturerSigma-Aldrich
- Product numberG2269
- Product descriptionGastric Inhibitory Polypeptide human ≥95% (HPLC)
- Packaging.1mg
- Price$358
- Updated2022-05-15
- Buy
- ManufacturerSigma-Aldrich
- Product numberG2269
- Product descriptionGastric Inhibitory Polypeptide human ≥95% (HPLC)
- Packaging0.5mg
- Price$1850
- Updated2026-04-30
- Buy
- ManufacturerSigma-Aldrich
- Product numberG2269
- Product descriptionGastric Inhibitory Polypeptide human ≥95% (HPLC)
- Packaging0.1mg
- Price$459
- Updated2026-04-30
- Buy
| Manufacturer | Product number | Product description | Packaging | Price | Updated | Buy |
|---|---|---|---|---|---|---|
| aablocks | AA01EAXE | Gastric inhibitory polypeptide (human) 98% | 1mg | $345 | 2026-05-30 | Buy |
| aablocks | AA01EAXE | Gastric inhibitory polypeptide (human) ≥95%(HPLC) | 10mg | $2119 | 2026-05-30 | Buy |
| ApexBio Technology | B5255 | GIP(human) | 1mg | $520 | 2021-12-16 | Buy |
| ApexBio Technology | B5255 | GIP (human) | 1mg | $244 | 2026-05-06 | Buy |
| Arctom | HY-P0276 | GIP, human 99.94% | 1mg | $475 | 2026-05-26 | Buy |
| Arctom | HY-P0276 | GIP, human 99.94% | 5mg | $931 | 2026-05-26 | Buy |
| Biosynth | CRB1000991 | GIP, human | 1mg | $523.35 | 2026-06-04 | Buy |
| Biosynth | PGR-4178-S | GIP (Human) | 0.1mg | $515.15 | 2026-06-04 | Buy |
| Biosynth | CRB1000991 | GIP, human | 0.5mg | $331.46 | 2026-06-04 | Buy |
| Biosynth | PGR-4178-V | GIP (Human) | 0.5mg | $1733.92 | 2026-06-04 | Buy |
| ChemScene | CS-7025 | GIP, human 99.94% | 1mg | $542 | 2026-06-04 | Buy |
| ChemScene | CS-7025 | GIP, human 99.94% | 5mg | $1062 | 2026-06-04 | Buy |
| Sigma-Aldrich | G2269 | Gastric Inhibitory Polypeptide human ≥95% (HPLC) | .5mg | $1440 | 2022-05-15 | Buy |
| Sigma-Aldrich | G2269 | Gastric Inhibitory Polypeptide human ≥95% (HPLC) | .1mg | $358 | 2022-05-15 | Buy |
| Sigma-Aldrich | G2269 | Gastric Inhibitory Polypeptide human ≥95% (HPLC) | 0.5mg | $1850 | 2026-04-30 | Buy |
| Sigma-Aldrich | G2269 | Gastric Inhibitory Polypeptide human ≥95% (HPLC) | 0.1mg | $459 | 2026-04-30 | Buy |
Properties
storage temp. :−20°C
form :Solid
color :White to off-white
Water Solubility :Soluble to 1 mg/ml in water
Sequence :H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH
InChIKey :MGXWVYUBJRZYPE-YUGYIWNOSA-N
form :Solid
color :White to off-white
Water Solubility :Soluble to 1 mg/ml in water
Sequence :H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH
InChIKey :MGXWVYUBJRZYPE-YUGYIWNOSA-N
Safety Information
| Symbol(GHS): | ||||||||
|---|---|---|---|---|---|---|---|---|
| Signal word: | ||||||||
| Hazard statements: |
|
|||||||
| Precautionary statements: |
|
Description
GIP was originally isolated as a gastric inhibitory polypeptide. After the discovery of its glucose-dependent insulinotropic activity, known as the incretin effect, GIP was renamed glucose-dependent insulinotropic peptide.Gastric inhibitory peptide
Abbreviation: GIP
Additional names: gastric inhibitory polypeptide,gastrointestinal inhibitory peptide, glucose-dependent, insulinotropic peptide
Related product price
-
15522-69-7
$18.7-663 -
N-BUTYLISOCYANIDE
$45-1028.41 -
SALCOMINE
$6-4889.68
Suppliers and manufacturers
Dingwang Technology (Wuhan) Co., Ltd.
Shenzhen Nexconn Pharmatechs Ltd
BOC Sciences
Shanghai Longyu Biotechnology Co., Ltd.
Cellmano Biotech Limited
Zhejiang J&C Biological Technology Co.,Limited
Hangzhou Go Top Peptide Biotech
Alfa Chemistry
Chengdu Youngshe Chemical Co., Ltd.
GIP (HUMAN)
CAS:100040-31-1




