Welcome to chemicalbook!
+1 (818) 612-2111
RFQ
Try our best to find the right business for you.
Do not miss inquiry messages Please log in to view all inquiry messages.

Welcome back!

RFQ
skype
MY Account
Top
Postion:Product Catalog >Biochemical Engineering>Amino Acids and Derivatives>IGF-1 DES
IGF-1 DES
  • IGF-1 DES
  • IGF-1 DES
  • IGF-1 DES

IGF-1 DES NEW

Price $55 $45
Package 1box 10box
Min. Order: 1box
Supply Ability: 50000vials
Update Time: 2024-08-15

Product Details

Product Name: IGF-1 DES Min. Order: 1box
Purity: 99% Supply Ability: 50000vials
Release date: 2024/08/15

IGF-1 DES (Insulin Growth Factor – 1 DES) is a single, non glycosylated polypeptide chain that is made up of 67 amino acids. It is the shorter version of the IGF-1 amino acid chain that contains amino acids 4-70 and as such it mimics the insulin structure. This polypeptide omits the first three amino acids at the N-terminus of IGF-1 and this omission considerably lowers its binding to the IGFBPs (insulin-like growth factor-binding proteins) and boosts its potency. Its structure has ensured that the properties of IGF-1 can be amplified with more stability. IGFs (somatomedins) are growth hormones that play a great role in growth and development. IGF-1 DES is also synthesized naturally in the human body and its physiological role is to positively impact protein synthesis, RNA synthesis, transportation of amino acids and glucose into the cells, and to lower protein catabolism. It is also believed to promote neurogenesis and functions. Its amino acid sequence is TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA and it has a molecular mass of 7372 Daltons. IGF-1 DES is also referred to as IGF-1 DES, IGF-1, IGF-1 DES 1-3, Somatomedin C analogue, Detropin. It has a half-life that ranges between 20-30 minutes (it is a very delicate amino acid chain) and its potency is 5 times that of IGF-1 LR3 and 10 times that of regular base IGF-1

Company Profile Introduction

You may like

Recommended supplier

Product name Price   Suppliers Update time
$30.00/1mg
VIP3Y
Anko Intermational Trade Limited
2023-04-11
$9.90/1mg/via
Wuhan Cell Pharmaceutical Co., Ltd
2023-04-11
$130.00/500mg
VIP4Y
Wuhan Senwayer Century Chemical Co.,Ltd
2022-11-02
  • Since: 2019-09-10
  • Address: Wanxiangcheng Office Building,Shijiazhuang
INQUIRY